KEGG   Bacillus pseudofirmus: BpOF4_05330Help
Entry
BpOF4_05330       CDS       T01165                                 

Definition
(GenBank) hypothetical protein
  KO
K06958  RNase adapter protein RapZ
Organism
bpf  Bacillus pseudofirmus
Brite
KEGG Orthology (KO) [BR:bpf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bpf03019]
    BpOF4_05330
Messenger RNA biogenesis [BR:bpf03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     BpOF4_05330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_2 AAA_18 Myosin_head AAA_16 AAA_22 NB-ARC
Motif
Other DBs
NCBI-ProteinID: ADC49128
UniProt: D3FYA5
LinkDB All DBs
Position
complement(3320929..3321822)
Genome map
AA seq 297 aa AA seqDB search
MTNQEEIQIVIITGMSGAGKTVAVQSFEDLGYFCVDNLPPALIPKFVDLLKGSNGTMNKV
ALVIDLRGKAFFDHLFEAIDAISIEENIQLKMQILFLDAKDAKLVQRYKETRRSHPLAKG
GLPLDGIKKERELLEELKGRAQQIIDTTEMKPIQLRERIIQRFKTTDRHPFSINIMSFGF
KYGIPIDADLVFDVRFLPNPHYVDHLRPQTGLNEEVSSYVLKWSETQTFIEKLRDLLTYM
LPQYKREGKSQVVIGIGCTGGKHRSVTLAEYFGEAFSNEYVMHVSHRDIEKGKEKTT
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatcaagaagaaatacaaatcgtaatcatcacaggaatgtctggggcaggaaaa
actgtggctgtccaaagttttgaagacttaggatatttctgtgtggataatttgccgcct
gctttaattccaaaatttgttgatctcttaaaaggatctaacgggacgatgaataaagtc
gcactcgtcattgaccttcgcgggaaagcattttttgatcatttatttgaggcaattgat
gcgatcagcatagaagaaaacatccagcttaaaatgcaaattttgttcttagatgcaaag
gatgccaagctcgtacaacgctacaaagaaacgagaaggtctcatccattagctaaaggc
gggcttccgctggatggaattaaaaaagaacgtgaattgcttgaagagttaaaaggccgc
gcccagcaaattattgatacaacagagatgaagccaatccagctgcgtgagagaatcatc
cagcgctttaaaacgacggaccgtcatccattctcgatcaatattatgtcgtttggcttt
aaatacggaattccgattgatgccgaccttgtttttgatgtgagattcctgcctaaccct
cattatgtcgatcatctaagacctcaaacaggattaaatgaagaggtttcatcttatgta
ttaaagtggagtgaaacacagacatttattgaaaagcttcgtgacttgctgacgtatatg
cttcctcagtataaacgtgaagggaagagccaggtcgtcatcggaattggatgtactggc
ggaaagcaccgttcggttactttagcggaatactttggtgaggcattttcaaatgagtat
gtaatgcatgtgagtcatagagatattgaaaaggggaaggaaaaaacaacgtga

DBGET integrated database retrieval system