KEGG   Bacillus pseudofirmus: BpOF4_06690Help
Entry
BpOF4_06690       CDS       T01165                                 

Gene name
yjmD
Definition
(GenBank) putative oxidoreductase
Organism
bpf  Bacillus pseudofirmus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ADC49396
UniProt: D3G0C1
LinkDB All DBs
Position
complement(3613201..3614094)
Genome map
AA seq 297 aa AA seqDB search
MHIYHGTNPLATYPRIIGHEVTGEVVKAGESVSRLKEGDKVVLEPIDTCGECYACRNGRA
NVCEKLEVYGVHRDGGMQEYMVVNEAHLHKVDASIPFEDSVLVEPFTIGAQANWRGNVQK
GDTVLIQGAGPIGICCLKVTKLLGATCFITDLSEERLDFAVKCGADKVIHAGKEDVVETV
MEATAGEGANVVIDAVCLPQTFELGIHAASIAGHVVVLGFDERPSTISQLPITKKELTIV
GSRLQTNQFEKVIKWMEEKELNVDEMVTHTFSIDEIKEAMSFIENNPNEVRKAVISM
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcatatctaccacgggaccaatccattagctacgtatccgcgtattattggacatgaa
gtgacaggtgaagtcgtcaaagcgggggagagtgtgtcccgtttaaaagaaggcgataag
gtggtactagagccaattgatacatgcggcgagtgctatgcatgccgtaatggccgagca
aatgtgtgcgaaaagcttgaagtatatggtgtacaccgcgacggcggcatgcaggaatat
atggtcgtaaacgaagctcaccttcataaagttgatgcatcgattccctttgaagattcg
gtattagtagagccatttacgatcggggcacaagcgaactggcgcggaaatgtccaaaaa
ggtgacaccgtgttaattcaaggagcaggtccgattggcatctgctgtctcaaagtgaca
aagctgcttggagccacatgctttatcaccgatctaagtgaagaacgattagactttgcc
gtaaagtgcggagcagataaagtgattcatgctggtaaagaggatgtagtggagacggta
atggaagcaacggctggtgaaggggccaatgttgtcattgatgcggtatgtctcccgcaa
acattcgaattaggcatccacgcagcatccattgccggacatgttgtggtactagggttt
gatgagcgtccatcaacgatctctcaacttccaattactaaaaaagaattaacgattgtc
ggatcacgtctgcaaacgaaccaatttgaaaaagtcattaagtggatggaagaaaaagag
ctgaatgtagatgaaatggtcacacataccttctctattgatgagattaaagaagcgatg
tctttcattgaaaacaatccaaatgaagtacgaaaagcagtaatctccatgtaa

DBGET integrated database retrieval system