KEGG   Bacillus pseudofirmus: BpOF4_07760Help
Entry
BpOF4_07760       CDS       T01165                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase (large subunit)
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bpf  Bacillus pseudofirmus
Brite
KEGG Orthology (KO) [BR:bpf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BpOF4_07760 (ahpF)
Enzymes [BR:bpf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BpOF4_07760 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored DAO FAD_binding_3 Thi4 AlaDh_PNT_C Glutaredoxin K_oxygenase NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: ADC49610
UniProt: D3FQD8
LinkDB All DBs
Position
3819464..3820993
Genome map
AA seq 509 aa AA seqDB search
MLLEADVKAQLNEYLKLLEGDILLKVSAGDDSVSKDMLALVDELASMSSKISVRQAELER
TPSFSVNRIGEETGVTFAGIPLGHEFTSLVLALLQVSGRAPKVDQSVIDQIKNMDGEYHF
ETYVSLSCHNCPDVVQALNMMSVLNPGITHTMIDGAAFKEEVESKNVMAVPAVYLDGEFF
SGGRISLEETLAKLGTGPDAAELSNKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVLDTMSIENFISVKSTEGPKLAASLEEHVKEYNIDIMNLQRAKNLEKNDLFELELE
NGAVLKSKSVIVSTGARWRNVGVPGEQEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVNHVTVLEFMPELKADEVLQKRLYSLPNVTVVKNVQTKEITGTDSVNGITY
IDRETEEEHHVELAGVFVQIGLVPNTDWLDGFVERNRMGEIMVDKSGATTVPGLFAAGDC
TDGPYNQIIISMGSGANASLAAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgttacttgaagcagatgtgaaagcccaacttaatgagtacctgaaactcctagaaggt
gatatccttcttaaagtgagtgcaggtgacgattccgtatcaaaagatatgcttgcacta
gttgatgagctagcatccatgtcctctaagatctctgttagacaagcagagcttgagaga
acacctagctttagtgtaaaccgtatcggagaagagacaggcgttacatttgctggtatt
cctttagggcacgagtttacatcactcgtgctcgctttactgcaagtgagtggtagagca
ccaaaagttgatcaaagcgtcattgaccagatcaaaaacatggacggggaatatcacttt
gaaacgtatgtcagcctaagctgccataactgtcctgatgttgttcaagcactgaatatg
atgagtgtcctaaaccctggtataactcacacgatgattgacggtgcggcatttaaagaa
gaagtagaatcgaaaaatgtcatggctgttcctgctgtctatttagatggtgagttcttt
agcggcggacgcatttcactagaagaaactttagcaaaattgggaacaggtcctgatgct
gctgaactttcaaataaagatccttatgatgttcttgtggttggcggaggtcctgcaggg
gcaagtgcagcgatctatgcagcacgtaaagggatccgcacaggtattgttgctgaacgt
ttcggcggacaagtccttgatacaatgagcatcgagaactttattagcgtgaaaagcaca
gaaggtccaaagcttgcagcaagccttgaagagcacgtaaaagagtacaatattgatatt
atgaacttacaacgtgcgaagaaccttgagaaaaacgacttatttgagcttgagcttgaa
aatggggctgtactgaaaagtaagagcgtcattgtatcaactggggctcgctggcgtaat
gttggcgttccaggcgaacaagagttcaagaacaaaggtgtcgcttactgccctcactgc
gatggtcctctatttgaaggaaaagatgttgcagttatcggcggcggtaactcaggaatt
gaagcagcaattgaccttgctggaatcgtaaaccacgtaactgtccttgaattcatgcct
gaactaaaagcagatgaagtccttcaaaaacgcttatacagcttaccgaatgtaacggta
gtgaaaaatgttcaaacaaaagaaatcactggcacagacagcgtaaatggtattacgtac
atcgaccgtgaaacggaagaagagcatcatgttgaattagcaggtgtcttcgttcaaatc
ggtcttgtaccaaatacagactggttagacggttttgttgaacgcaaccgtatgggtgag
atcatggttgataagagcggtgctacaaccgttcctggcctcttcgctgcaggagactgc
acagacggtccttacaaccaaatcattatctcaatgggctcaggtgcgaatgcatcacta
gcagcgtttgattatttaattaggaattaa

DBGET integrated database retrieval system