KEGG   Bacillus pseudofirmus: BpOF4_13895Help
Entry
BpOF4_13895       CDS       T01165                                 

Gene name
sod
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bpf  Bacillus pseudofirmus
Brite
Enzymes [BR:bpf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BpOF4_13895 (sod)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ADC50830
UniProt: D3FYH8
LinkDB All DBs
Position
1200669..1201277
Genome map
AA seq 202 aa AA seqDB search
MAYELPQLPYAANALEPHIDEQTMNIHHGKHHNTYITKLNAALEGHDDLQSKSIEELVSN
LDAVPENIRGAVRNNGGGHANHTFFWQILSPNGGGAPTGELADAINSEFGSFEAFKEKFA
DAGANRFGSGWAWLIVDGGKLAVTSTPNQDTPLMEGKTPILGLDVWEHAYYLNYQNRRPD
YINAFWNVVNWEEVSKRYAEAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgaattaccacaattaccttacgcagcaaacgctctagaacctcatattgat
gagcaaacaatgaatattcaccacgggaagcatcacaacacttacatcactaaattaaat
gcagcacttgaaggacatgatgatcttcaaagcaaaagcattgaagagcttgtaagtaac
cttgatgcagtacctgagaacattcgtggtgcagtacgtaacaatggtggcggacatgct
aaccacactttcttctggcaaatccttagcccgaatggtggcggtgcaccaactggcgaa
ttagcagatgcaattaattcagaatttggcagctttgaagcattcaaagagaagtttgct
gatgcaggggctaaccgtttcggttctggttgggcatggctaattgttgatggcggaaag
cttgctgttacaagcactccaaaccaagatacgcctcttatggaaggtaaaacaccaatc
ctaggattagatgtttgggagcacgcttactacttaaactaccaaaaccgtcgtcctgac
tacatcaacgcattctggaatgtagttaactgggaagaggtttcaaaacgttacgctgaa
gcaaaataa

DBGET integrated database retrieval system