KEGG   Bacillus pseudofirmus: BpOF4_14965Help
Entry
BpOF4_14965       CDS       T01165                                 

Gene name
sod2
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bpf  Bacillus pseudofirmus
Brite
Enzymes [BR:bpf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BpOF4_14965 (sod2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Phage_TTP_12
Motif
Other DBs
NCBI-ProteinID: ADC51042
UniProt: D3FZV7
LinkDB All DBs
Position
1401968..1402849
Genome map
AA seq 293 aa AA seqDB search
MGYNDRLYEWAEDIKQLWNEQGEFIESQVGKQKTVSFVSSLTSLLNSMEEQQLLRDSADY
ENEAWEVYDAWHKMFSDKRYDGGVRAVPIGGHTLPPLPYAYNALEPYIAEEIMRLHHDKH
HQSYVDGLNKAENAMQGARETGDFSLIKHWEREAAFHGSGHYLHSIFWEIMNPDGGGEPS
GELLEQINHDFGSFEQMKKHFSEAANAVEGGGWAILVWSPRSHRLEILQAEKHQNLSQQD
QIPLLVLDVWEHAYYLQYKNERKPYIENWWNIVNWPAVEERYATAKQVRWQPY
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgggatataatgaccggctgtatgaatgggctgaggacataaagcagctttggaatgaa
caaggggaattcattgaaagtcaggttgggaaacagaaaacagtatcttttgtaagctcc
ttaacgtcattattaaactcaatggaagagcaacagctgctaagagattccgctgactat
gaaaatgaggcatgggaagtttatgacgcttggcataagatgtttagtgataagagatat
gacgggggagtacgcgcagttccgattggcggccatacactcccgccattgccgtatgct
tataatgcactagaaccttacattgcagaggaaattatgcggctgcaccatgataagcat
catcaaagttatgtagatggcctgaataaagctgaaaatgccatgcagggggccagagaa
acaggtgacttctctctcattaaacattgggaaagagaagctgcttttcacggatcaggt
cattaccttcattcaatcttctgggaaattatgaatcctgatggcgggggagaaccaagt
ggagaactgttagagcaaatcaatcacgattttggttcatttgaacagatgaaaaaacat
ttttcagaagcggcaaacgcagtggaaggtggagggtgggccatattggtttggtcaccg
aggtctcatcgcctcgagatcctgcaagcggaaaagcatcaaaacctttctcagcaagat
caaattccgttgcttgtcttagatgtatgggagcatgcttattacctgcagtataaaaat
gaaaggaagccatatatcgaaaattggtggaacattgtaaactggccggctgtcgaagag
cggtatgcaacagcgaagcaagtaagatggcagccttattaa

DBGET integrated database retrieval system