KEGG   Bacillus pseudofirmus: BpOF4_18925Help
Entry
BpOF4_18925       CDS       T01165                                 

Gene name
odhA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bpf  Bacillus pseudofirmus
Pathway
bpf00020  Citrate cycle (TCA cycle)
bpf00310  Lysine degradation
bpf00380  Tryptophan metabolism
bpf01100  Metabolic pathways
bpf01110  Biosynthesis of secondary metabolites
bpf01120  Microbial metabolism in diverse environments
bpf01130  Biosynthesis of antibiotics
bpf01200  Carbon metabolism
Module
bpf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BpOF4_18925 (odhA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    BpOF4_18925 (odhA)
   00380 Tryptophan metabolism
    BpOF4_18925 (odhA)
Enzymes [BR:bpf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BpOF4_18925 (odhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N PFOR_II
Motif
Other DBs
NCBI-ProteinID: ADC51824
UniProt: D3FSV9
LinkDB All DBs
Position
complement(2128170..2131016)
Genome map
AA seq 948 aa AA seqDB search
MSSKEHKPEEPWQGFHGPNLGVAIELYEEFTKDPEAVEEDLRELFEQWGPPPSSTQTEPV
QATNAPSANQAAGADMMRKFVGATKLADMIRTKGHLAADVHPIHKDKKNEELIELSRYGL
TEADLKQVPVDLICPDAPSHVKDGLDAIKHLKNVYTKTIAFEFGHVHDEEERQWLNKMVE
SGIYLPNLSKQQKVALLKRLTQVEGFEKFIHRTFVGQKRFSIEGLDIMVPMLDEVVRESV
HEGTEHVMIGMAHRGRLNVLAHTLSKPYKMIFSEFLHAPNKDLVPSEGSTGINYGWTGDV
KYHLGADRQIKEENTVEATVSLANNPSHLEFVSPIVEGYARAAQEVRTKKGDPEQTVSKA
YSILIHGDAAFPGQGIVTETLNLSRLTGYQTGGSLHIIANNNIGFTTETYDSRSTTYASD
PAKGFEIPIVHVNADDPEACLAAMHLAFQYRKRFKKDFLIDLIGYRRFGHNEMDEPAVTQ
PGLYQKIRAHKTVRVLYADQLVASGEIESGYGEQLDKEAQEYLQSQYDAVAGNKSNKAKE
IVTPDFIVSGLPKVKTSVEFNTLKSINEQLLTWPEQFKPNEKLEKILKRRLQSFEGEGKI
DWALAETLAFASILHDGTPIRLSGQDSERGTFAHRHLVLHDRETNETHTPLKEFDDANAS
FSVHNSPLSEMAVVGFEYGYNVFAPETLVLWEAQFGDFANGAQVMFDQWVSAGRAKWGQK
SGLVCLLPHGYEGQGPEHSSGRVERFLVLAAENNWTIANCTSAAQYFHILRRQAAILEKD
SVRPLIIMTPKSLLRNQVVASTHAEFTEGEFKPVFEQAGLGEAADKVERIVLCSGKVAID
LADRVKKSDENWDWLHIARVEELYPFPKKQIRELFARYSNLKEIVWVQEEPKNMGAWPFI
ESRIREITPSEASVSYIGRTHRSSPAEGDPVAHKKEQDRIITESLTRK
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaaggagcacaaaccggaagagccatggcaaggatttcatggtccgaacctt
ggcgtcgcaattgagttgtatgaagaattcactaaagacccagaagctgtagaggaagac
ctacgcgaattatttgaacaatggggtccaccgccttcttctactcaaactgaacctgtt
caagcgacaaatgccccttcagcaaaccaagctgcaggagcggacatgatgaggaagttt
gtcggagcaacaaagcttgccgacatgattagaacgaagggccatttagcagccgacgtt
cacccgattcataaggataagaagaatgaagagttaattgaactttctcgctacggttta
accgaagcagatctgaaacaagtaccagttgatttaatttgtccagatgccccttcacat
gttaaggacggtttagatgcaatcaaacacttaaaaaatgtttatacaaagacaattgca
ttcgaatttggtcatgtacatgatgaggaagagcgtcaatggttaaataagatggtggaa
tccggtatctacttgccgaatctatcaaaacaacaaaaagttgcattacttaagcgttta
acacaagttgaaggatttgagaaatttattcatcgtacgtttgttggacaaaagcgcttc
tctatcgaagggcttgatattatggtgccgatgcttgatgaggttgttcgtgaatctgtc
catgaaggaacagagcatgtcatgattggtatggcgcaccgcggacgtttgaatgtatta
gcgcacacactaagcaagccttacaaaatgatcttctctgagtttttacatgctcctaac
aaagatttagtgccttcagaaggatcaactggcattaactacggttggacaggagatgtg
aagtatcacttaggtgctgatcgtcaaattaaagaagagaatacagtagaagcaacggtt
tcacttgcaaacaacccgtctcaccttgaattcgtgagtccaattgtagaaggttatgca
cgtgcagctcaagaagtacgtacgaaaaaaggcgatccagagcaaacggtttcaaaagca
tattcaatcttaatccacggagacgctgctttcccaggacaagggattgttactgaaact
ctaaacctctctcgtctaacaggttatcaaacgggtggatcacttcatattattgctaac
aataatattgggttcactactgaaacgtatgattcacgttctactacatatgcaagtgac
ccagctaaagggtttgaaattccgatcgttcatgtcaatgcagacgatcctgaagcctgt
cttgctgctatgcatcttgcatttcaatatcgaaagcgtttcaaaaaggatttcttgatt
gacttaatcggatatcgtcgcttcggtcacaatgaaatggatgagccggctgttactcaa
ccaggactttatcaaaaaatcagagcgcacaaaacggtacgtgtgctgtatgcagaccaa
ctagtcgctagcggtgaaattgagtcaggatacggcgagcagctagataaagaagcccaa
gagtaccttcaatcacaatatgatgcggttgcaggcaataagtctaataaagcaaaagaa
atcgttacacctgatttcattgtaagcggacttccaaaagtgaagacttcagttgaattt
aatacactaaagtctattaatgaacaattgctgacgtggccggaacaatttaaaccaaat
gaaaagcttgagaaaattcttaagcgtcgtcttcaatcgtttgaaggggaaggtaaaatt
gactgggcattagctgaaacacttgcatttgcttcaattttacatgatggtactccaatt
cgtctttcaggtcaggattcagaacgtggtacatttgcacatcgtcacttagtgctgcat
gaccgtgaaacgaacgaaacacatacgccgcttaaagaatttgatgatgcgaacgcgtcg
ttctctgttcataacagcccgctttctgaaatggctgtagtcggctttgagtatggctac
aacgtatttgcacctgagactcttgttctatgggaagctcaatttggagatttcgctaac
ggtgctcaagtaatgtttgatcaatgggtatctgcagggcgtgctaagtggggccaaaaa
tcaggacttgtatgtcttttgccacacggatatgaagggcaaggacctgagcactcaagc
ggccgtgttgaacgtttcttagtacttgcggctgaaaataactggacaattgctaactgt
acatcagcagcgcaatatttccacattttacgtcgtcaagcggctatccttgaaaaagat
tcggttcgtccgttaattattatgacaccaaaaagtctgcttcgtaatcaagttgttgct
tccacgcatgctgaatttactgaaggagaattcaagcctgtgtttgaacaagctggctta
ggtgaagctgcagataaagtagaacgtattgtcctttgcagcggtaaagtagcgattgac
cttgcagaccgtgtgaagaaatctgacgaaaactgggattggcttcacattgcacgtgtt
gaagagctgtatccgttcccgaaaaagcaaattcgcgaattatttgctagatactcaaac
ttaaaagagattgtttgggttcaagaggagcctaagaatatgggtgcttggccatttatc
gagtcacgcatccgtgagattacacctagcgaggcatcggtttcatacattggacgtact
catcgttcaagtcctgctgaaggtgacccggttgcacataagaaagaacaagatcgtatc
atcacagaatcattgactcgcaaataa

DBGET integrated database retrieval system