KEGG   Bathycoccus prasinos: Bathy01g00030Help
Entry
Bathy01g00030     CDS       T03089                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bpg  Bathycoccus prasinos
Pathway
bpg00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bpg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Bathy01g00030
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpg02000]
    Bathy01g00030
Enzymes [BR:bpg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Bathy01g00030
Transporters [BR:bpg02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bathy01g00030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_N GST_C GST_C_5 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 19017739
NCBI-ProteinID: XP_007515112
UniProt: K8E8R2
LinkDB All DBs
Position
1:3323..4720
Genome map
AA seq 465 aa AA seqDB search
MSSTSSKKKRITNATVVEVDGSNAPSWKDLERIATDLKKKHDIPETIDLEAGPTSPKCLK
RTFGKTDEEIRVHFYRDHAGWCPYCETVWLLLEEKRIPYTVEKINMRCYGDKPQSFLKNV
PSGMLPVVVIDGVLMTESAVIQEALETKFSDVASYPAMLPPNESSEAQTLFRLERKLFSN
WMQWLTGNWNDAASRATFCETLDEVDLRLSETVDSPYFLNSGFSLVDIKFAPFLERMAAS
LLYYKGLRIEGSKRWPHIDNWFANMSNRPTFRMIRSDYFTHVHDLPPQLGGCVENNTQEQ
IDAMSAINGRDGKSWQLPLPPLNESSLEPLWEKENPERDRLEAAIQLLSNYENVSRFACR
GASATPSKKRVSAPLSDPFATPNEDYVEAVDVALRTVAAMLLRTDNSDIPQGCENVLGTN
ASQVTKKNVSLSLEYLRDRVGVPRDMRMPAARQLRSHLNFAISHL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgacgtcgagcaagaagaaaagaataacgaacgcgactgtagtcgaggtcgac
gggtcgaacgctccatcgtggaaagacttggagcgcatcgcgacagatttaaagaagaaa
cacgacattccagaaactatagatttagaagcaggcccgacgtcaccgaaatgtttgaaa
cgaacttttggtaaaaccgatgaggagattcgcgttcacttttatcgagaccacgctggg
tggtgtccgtattgtgagaccgtttggctgttgctggaagaaaaacgaattccgtacacg
gtagaaaagatcaacatgcgatgttatggagataaaccgcagagttttttgaagaatgtg
ccgagtggaatgctcccggttgtcgtcatcgacggcgtcttgatgacagagtctgcggtg
atccaagaagctctcgagacaaagtttagcgacgtagcttcgtatcctgccatgctacca
ccaaatgaatcatcggaggcacagacacttttcaggttagagcgtaaattgttctctaat
tggatgcaatggctgactggaaattggaacgacgcggcgagtcgagcgactttctgtgaa
accttggatgaagtcgatttgagacttagcgagacggtagattctccatatttcctgaat
tctggcttttcgcttgtcgatataaagtttgctccgtttcttgaacgcatggcggcttca
ttgttgtactacaaggggttgagaatcgaaggttcgaaacgatggccgcacatcgataat
tggttcgcgaacatgtcgaacagaccgacgtttcgtatgatacgaagtgattattttacg
cacgtacatgatttaccgcctcaacttggaggctgcgttgagaacaacacgcaggaacaa
atcgacgcgatgagcgcgattaatggtcgggatggtaaatcgtggcaactgccactccct
cctttgaacgagtcgtcgctggaacctctctgggagaaagaaaatccagaaagagatcga
ttggaagctgcaatacaacttttgagtaattacgagaatgtcagtcgcttcgcgtgtcgt
ggcgcaagtgcgacgccgtcgaaaaagagagtttctgcgccgttatcagacccattcgcg
acaccgaacgaagactacgttgaagcagtggatgtagcgttgcgaactgtagccgctatg
cttttgcgcacggataatagcgatattccgcaaggatgtgagaacgtattgggtacaaac
gcttcgcaggtaacaaagaagaacgtgtcgttatctctcgagtatttgcgagacagagta
ggcgtccccagagatatgcgaatgcccgccgcgcgacaacttcgcagccatttaaatttt
gcgatatcacatttgtaa

DBGET integrated database retrieval system