KEGG   Bathycoccus prasinos: Bathy02g03490Help
Entry
Bathy02g03490     CDS       T03089                                 

Definition
(RefSeq) alpha amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
bpg  Bathycoccus prasinos
Pathway
bpg00500  Starch and sucrose metabolism
bpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bathy02g03490
Enzymes [BR:bpg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Bathy02g03490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase PG_binding_1 YHYH Flg_hook HSBP1
Motif
Other DBs
NCBI-GeneID: 19017462
NCBI-ProteinID: XP_007514848
UniProt: K8F0M6
LinkDB All DBs
Position
2:complement(join(653366..656798,656948..657246))
Genome map
AA seq 1243 aa AA seqDB search
MSAMLSSRRVSVHVPGGGGGTKAAFSRRSAFVSGMRPLHRTAVKKSSSSSRRPKNAGRRR
MISSSSSSRDLFEGDEGFDVELLQKDLVEEGLLDQKHANGHFNGQTTEAIATLQQQFGLP
VTGEWTELERLVFQGGAQKSQRVRNFNDRNAGERALAPPTARGKRALENAQMYYTSVEDS
RDLIRDGSDALQRFVQPGLSGDILTGLVWGLGVASAVSFTNDLFEDYLQPVGRQKSKEHQ
RRWNETPNDEGLLPKLNFFGGGGSGGNGGRIQRAFKQGGGRGQRQQEQQQPFERGVAYAS
SSSSSPQRDSGNGGTVPYWQTGRTSRMLQEYHGASASSSSSNFVPPANAPGSNVPPSPAF
AHMNTNASASMSVKEMNALRKEITRRNASQAFAQYNNSSGDAPAQKRNTKIGSRDAALEP
IRAKARTQTLERPGYANDGFGEYGNKNDRNGNNSSTSSSSSSSSNNNNPGDAMDEHNRGP
LYVQGLDFLREIPSKVPNLFAPSEFSARAIKERELEASIQEARRIAESERAEKHKAQEAF
ARQKSELLEVSRIARQASFVADSHEQRIKEIQEKLNSMQVNEGTKMESLVSRIDELESFV
NKSLQDKFENLEVAAERKFKQLAVDVERIELAMKDAGSNLDELDTIGQVTMALSSVKNDV
TAKLQAFEAQLNEQLEATSRQLKEDRESDTRADIAFAKLDALEHSLLDVQSGAGAEIERL
QAHIDRLEASLRAAPAPVVVEEEEEEIIREEEKEEVIIPTSSAYTEVDTLEELDVAKEQE
QEQEIVEEVVEEKKQQLENLFAAPAVPDVVIPIAPPVTPAPEVEKEDDFIDGQIFETGIP
KRIATGREVMLQGFHWESHKSEWYDIVSDRVEQIRDAGFTQVWLPPSADSLAPQGYLPRN
LYKLDSHYGSAEKLKSLTRKMKENNILPVLDAVLNHRCATHQGAGGKWNRWEGTGIDWGD
WAISNEQPDFAGSGNAPTGDVFHGAPNIDHTQDKVRQDLCEYMKYLTSDEVGFGGIRFDF
SKGYGGSFTGEYVRACEDNVEFAVGEFWDTMNYGVGLEYNQDSHRQAIVDWVDQTGGCCT
AFDFTTKGILQEACGRGEFWRLIDAQGRAPGVIGIWPARAVTFLDNHDTGSTQAHWPFPG
KQAGQGYAYILTHPGTPCVFWDHYFDWGDNLRKQIDSLLDVRDKMKIHARSVLKIEHAKD
NLYAAKIDDKVAVKLGREHWEPKGDGWKVEAFGDDWCVWTLTK
NT seq 3732 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgatgttatcttcgcgtcgggtttcggtgcacgttccaggaggaggaggagga
acgaaggcggcattctcgaggaggagcgcattcgtttccgggatgaggcctctgcatcga
accgccgtgaaaaaatcatcgtcgtcgtcgcgacgaccgaagaacgcggggaggaggagg
atgatctcgtcgtcgtcgtcgagcagagatttattcgaaggcgacgaaggcttcgacgtc
gagcttttgcagaaagatctcgtcgaggaagggctgttggatcagaaacacgcgaacgga
cacttcaacggccaaacgaccgaggcgatcgcgacgcttcagcaacagttcggtttaccc
gtcaccggcgaatggactgaactggaaagattggtgtttcaaggaggcgcgcaaaaaagc
caacgcgtgcgcaactttaacgacagaaacgccggcgagcgagcgttggcgcctccgacg
gcgagagggaagagggcgttggaaaacgcgcaaatgtattacacgagcgtggaggattcg
cgtgatttgatcagagacggtagtgacgcgttgcagcggttcgtacagcctgggctttct
ggagatattttgaccggattggtctgggggttgggcgtggcgagcgcggtgtcgttcacg
aatgatctttttgaagattatttgcaacccgtcggtcggcaaaaatcgaaagaacaccag
agaagatggaacgaaacaccaaacgacgaaggtttgttaccaaagttgaacttttttggc
ggcgggggtagcgggggtaacggcggtcgaatccaacgcgcatttaagcaaggaggagga
cgaggacagcggcaacaggaacagcaacaacctttcgaacgaggtgtggcgtatgcatct
tcttcctcgtcgtctccgcaacgagacagtggtaacggtggtacagttccgtactggcaa
actggacgtacttcgcgcatgttgcaagaataccacggagcttctgcttcctcgtcgtcg
tccaactttgtgccgccggcgaacgcgcctgggtcaaacgtgccgccttcgccggcgttt
gctcatatgaatacgaacgcgtcggcttcgatgagtgtgaaagagatgaacgcacttcga
aaagaaattactcgacggaacgcgagtcaggcgtttgcgcagtataacaacagtagcggc
gatgcgccggcgcaaaagagaaacacaaaaataggctcccgagacgccgccttggaacca
attcgagcgaaagctcgcacgcaaacgctcgagagaccgggatacgcgaacgacggcttt
ggcgagtatgggaataagaacgacagaaatggtaacaatagcagcaccagtagcagcagc
agcagcagcagcaacaacaacaacccgggggacgcgatggacgaacacaatcgagggcct
ctgtatgtccaaggcttggacttcctccgcgaaatcccgagcaaagttccaaacttgttc
gcaccgagtgagttctcagcacgagcgattaaagagcgcgagctggaagcgtcaatacag
gaggctcgtcggattgccgagagcgagcgcgcggaaaagcacaaagcacaagaggcgttt
gcgagacaaaaatctgaactcttggaggtttcgagaattgctcgtcaagcctctttcgtg
gctgattcgcacgagcaacgcatcaaagaaatacaagagaagttgaattcgatgcaagtt
aacgaagggacgaaaatggaaagtttagtcagtcgaatcgacgagttggaatccttcgtc
aacaagtctttgcaggataaatttgaaaatctcgaggtggcggcggagcgcaaattcaag
caactcgccgtcgatgtcgagagaattgaattagcgatgaaagatgccggctcgaatttg
gacgagctcgatacgattggtcaagttacgatggctttgtcgagcgtgaagaacgacgtg
actgcaaagttacaagcatttgaagcccaattgaacgaacaattggaagcgacgtcgaga
caattaaaagaggaccgagaaagcgacactcgcgccgatattgcgtttgcaaagttggac
gcgctggaacattctcttttggacgtccaatctggtgccggtgctgaaatcgagcgttta
caagcgcacattgatcgattggaggcgagcttgcgagccgctccggctcccgtggtagtt
gaagaagaagaagaagaaattatacgagaagaagaaaaagaagaggtcattattcccacc
tcgtccgcatacactgaagtggatacattagaggagttggacgtagcaaaagagcaggaa
caggaacaagaaattgtcgaagaagttgtggaagagaagaaacaacagctcgagaatctc
ttcgcggcgcccgccgtgccagacgttgtcattcccatagctccaccagtcactccggca
ccggaggttgaaaaagaggacgacttcatcgatggacagatattcgaaactggtattccg
aaacgcatcgcgaccggtcgtgaggttatgttgcaaggcttccactgggagtcacacaag
tctgaatggtacgacatcgtcagcgaccgcgtggagcaaatcagagacgccgggttcacg
caagtttggctccctccgtctgcggactcgctcgcaccgcagggttatttaccaaggaac
ttatacaagctcgactctcactacggatccgccgagaaactcaaatctttgactcgcaag
atgaaagaaaacaacatcttgccagtcttggacgccgtgttgaaccatcggtgtgcgacg
caccaaggtgccggcggaaagtggaaccgatgggagggcactggtattgactggggagat
tgggctatttccaacgagcaaccggactttgccggctctgggaacgctccaaccggcgac
gttttccacggcgcgccgaatatcgaccacactcaagacaaggttcgccaagatttatgc
gaatacatgaaatacttgacctccgacgaggttggtttcggtggtattagatttgatttc
tccaaaggttacggcggttcgtttacaggcgaatacgtccgggcttgtgaagataatgtc
gaatttgccgttggggagttttgggataccatgaactacggcgtcggattagaatacaac
caagactcgcacaggcaagccatcgttgattgggtcgatcaaaccggcgggtgttgcacc
gcgtttgatttcacgaccaaaggcatcttacaagaagcatgcgggcgcggcgaattctgg
cgtctcatcgacgcacaaggtcgcgctccgggcgttatcggtatatggcccgctcgagcg
gtaaccttcttggacaaccacgacacgggaagtactcaagcgcactggccattccccggt
aagcaagccggtcaaggttacgcgtatattttgacccacccgggtaccccgtgcgtcttc
tgggaccattacttcgattggggcgacaacttgcgcaaacaaatcgactctttactcgac
gtccgcgacaagatgaaaatccacgctcgatccgtcttgaaaatagaacacgccaaggat
aacttatacgccgctaagatcgacgataaagtcgccgtgaagttaggtcgcgaacactgg
gaacccaaaggtgacggatggaaagttgaagcgttcggcgacgactggtgcgtctggacg
ttgaccaagtag

DBGET integrated database retrieval system