KEGG   Bathycoccus prasinos: Bathy04g02850Help
Entry
Bathy04g02850     CDS       T03089                                 

Definition
(RefSeq) Ypk1p
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
bpg  Bathycoccus prasinos
Brite
KEGG Orthology (KO) [BR:bpg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bpg01001]
    Bathy04g02850
Enzymes [BR:bpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Bathy04g02850
Protein kinases [BR:bpg01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   Bathy04g02850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Pkinase_C Kdo APH
Motif
Other DBs
NCBI-GeneID: 19016311
NCBI-ProteinID: XP_007513581
UniProt: K8EDL4
LinkDB All DBs
Position
4:complement(542990..545134)
Genome map
AA seq 714 aa AA seqDB search
MASSSLKRVSGFQQPPLSPPSGGVTADSRGEEDEEDKDEKSSSKEVGAAAKTVFIEDASE
NAKQWMMAGLPPLPTTDKEVKKELNKLMRQESFTTSATTENKKTNVSRQQEVSKQTQNYY
YSSDSDVPQNATNTTMNKFNNKQTSALTSNLRRVDSTLLANTVMCRPEDDPDARLEESST
TAKDGKTQTTMKKLTPEDFEALYLVGQGAFGKVFQVRKKDTGVLYAMKVMKKEVVIAKEQ
MEYTKQERDILTSITHPYVVKLRFSFQTATKLYLVLDFINGGHLFYWMYREGMFDVGLTR
FYIAEIVCGIGHLHSLNIMHRDLKPENILVDREGHVRITDFGLAKKFSSDGEKANSLVGS
IDYMAPEILKDKGHGKEADWWSVGVLLYEMLIGQLPFRGKNKAAIQKAITSQKIKMPTFV
ENDAAKLIQNLTMKDPNLRLGSDVNLKKDSTSKNGTEEVKKHKFFSKINWAKLEKREVPA
PFVPKIDQDKGDGCVAHFDKKWTDAKVHAEAESAAASPSSAEQHHFLGFTYVSPTQLAYF
GSKMSIDENERFDGDDDDEEDDDDLRKLTAATRNMNMNNNNNTNTNRNSKSTKKNNNGNN
NNNNKNDGGDEELSFDSDEETALDGLNNDTTINSTFENDNRSSSKSSSLSSSRDEEDDAI
RQRFQQRTPPPRPNSNNTTSDAAASSSANTSGRTTPISVNKPKEGSRSQSPWMR
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtcgtctttgaaaagagtctctgggtttcagcaaccaccactttcaccacca
tcgggaggagttaccgctgattcgagaggagaagaagacgaagaagacaaagacgagaaa
tcatcatccaaagaagtgggggcggcggcgaaaactgtttttattgaagacgcgtcggaa
aacgcgaaacagtggatgatggcgggacttccgccgctgccgacgactgacaaagaggtg
aagaaagagctgaacaaactcatgcgacaggagagttttacgacttctgcgacgaccgag
aataaaaaaacgaatgtaagccgccagcaggaggtgtcgaagcaaacgcaaaactattat
tattcgtccgattcggacgtgccacaaaacgcgacgaatacgacgatgaacaaatttaat
aacaaacagacgagcgcattgacctcgaatttacgacgcgtagattcgacgttgttagcg
aacacggtgatgtgcaggccagaggacgatccggacgcgagattggaagagagcagtact
accgccaaggacgggaaaacgcagacgacgatgaaaaagttgacgccggaggatttcgag
gcgttgtatctcgtcggccaaggcgcgttcgggaaagtgtttcaagtgaggaagaaagat
accggggttctgtacgcgatgaaagtgatgaagaaagaggtggtgattgcgaaagagcag
atggaatatacgaagcaagagagggacattttgacgagcatcacgcacccgtacgtggta
aagttacgatttagtttccaaaccgcgacgaagttgtatttagttttagattttatcaac
ggtgggcacttgttttattggatgtatcgagaagggatgtttgacgttggattgacgaga
ttttacatcgcggaaatcgtctgcgggattggacatttgcactcgctgaacatcatgcac
agagatttgaaaccggagaatattttagtcgatagggaaggacacgtgagaattaccgat
tttggtttagcgaagaagtttagcagcgacggcgagaaagcgaactcgttggttgggagc
atcgattacatggcgccggaaattttgaaagataaaggtcacgggaaagaggcggattgg
tggtccgtcggcgttttgttgtacgagatgttgattgggcagttaccttttcgaggaaaa
aataaagcggcgatacaaaaggcgatcacgtcgcaaaagattaaaatgccgacgttcgtg
gaaaacgacgcggcgaaattgattcagaatttaaccatgaaagatccgaatttacgttta
ggaagcgacgtgaatctgaagaaagattcgacgtctaaaaacggcaccgaggaggtgaag
aaacacaagtttttttcgaaaatcaactgggcgaagctcgaaaaacgagaagtcccggca
ccattcgtgccgaaaattgaccaagataaaggggacgggtgcgtggcacactttgataag
aagtggacggacgcgaaagtccacgccgaagccgaatccgcggcggcgagtccgagctcg
gcggagcaacaccattttctcggattcacgtacgtttcgcccactcaattggcgtatttt
gggagtaagatgagcatagatgaaaacgaaaggtttgatggtgatgatgatgatgaggag
gacgacgacgatttgagaaaacttaccgccgcgacgaggaatatgaacatgaataataat
aataatactaatacgaataggaacagcaaaagcaccaagaagaacaacaacggcaacaac
aacaacaacaacaaaaacgacggcggggacgaggaactttcgttcgactccgacgaagaa
accgctctggacggtttgaataacgataccaccatcaactccacctttgagaacgacaat
cggtcttcttcgaagagcagtagtttatcttcctctcgcgacgaagaagacgacgccatc
agacaaaggtttcaacaacgaaccccaccgcctcgtcccaacagcaacaacaccaccagc
gacgccgccgcctcgagcagcgccaacacgagcggaagaacgacaccaatctccgtgaac
aaaccaaaagaaggaagccgaagccagtcgccttggatgcggtag

DBGET integrated database retrieval system