KEGG   Bathycoccus prasinos: Bathy04g04740Help
Entry
Bathy04g04740     CDS       T03089                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
bpg  Bathycoccus prasinos
Pathway
bpg00020  Citrate cycle (TCA cycle)
bpg00190  Oxidative phosphorylation
bpg01100  Metabolic pathways
bpg01110  Biosynthesis of secondary metabolites
bpg01200  Carbon metabolism
Module
bpg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bpg_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:bpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bathy04g04740
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Bathy04g04740
Enzymes [BR:bpg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Bathy04g04740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO Inp1
Motif
Other DBs
NCBI-GeneID: 19016500
NCBI-ProteinID: XP_007513731
UniProt: K8EE08
LinkDB All DBs
Position
4:928674..931001
Genome map
AA seq 775 aa AA seqDB search
MRRSHHGVTQSLKREIEKTLILRETSSASSSSARTTSSLSSKSFLSSSCSPSFFNRNTPI
TNGVRGKSVVVDDVIKTLHRHRRRHLLASSAHKHEEQKRGAATSAKSAQFSNTFGRRRRG
IATSTTTTSFLVGRRNSLQNEFVSTTSSRGGSKRAFSSSNAKNNGVNQPFGKEYEIIDHE
YDAVVVGAGGAGLRAAIGLSEHGYKTACVTKLFPTRSHTVAAQGGINAALGNMSEDDWRW
HAYDTVKGADWLGDQDAIQYMCREAPEAVRELERYGLPFSRTEEGKIYQRAFGGQSLEYG
KGGQAYRCACAADRTGHAMLHTLYGQALRHETQFFVEYFALDLIMDEQGACVGVLAMCLE
DGTLHRFRSHKTILATGGYGRAYFSATSAHTCTGDGNAMAARAGLPLQDLEFVQFHPTGI
YGAGCLITEGSRGEGGILRNSEGERFMERYAPSAKDLASRDVVSRSMTMEIREGRGVGKE
KDHIYLHLNHLPPELLAERLPGISETAAIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKGE
VVAPAKDGSDPDRVVPGLLAAGEAACASVHGANRLGANSLLDIVVFGRACANTVKESGLK
PGQKHKPLKNELNGEQSVKRLNDIRYNDKGAQNNKSTSELRKRMQRVMQDDAAVFRTQET
LAEGCMKIDQVAKEMESLHVTDKSLVWNTDLVEALELHNLMPNARITMHGAEQRKESRGA
HAREDFPDRLDDTWMKHTLGYIEEKDDSVKIDYRPVHHYTLDKEMDVIPPMKRVY
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgagacgatctcatcacggtgtaacacagtcgttaaaacgcgagatcgagaagacactc
atcttaagggaaacctcctctgcgtcgtcatcatctgctcgtacgacttcttctctttcc
tccaaatcatttttatcgtcgtcgtgttccccgtcatttttcaataggaatactcccatc
acgaatggtgttcggggaaaaagtgtcgtcgtcgatgacgtgatcaaaacgcttcatcgt
catcgtcgtcgacacctcttagcatcatcggcacacaaacacgaagaacaaaaacgcggc
gcagcgacttctgccaaatctgctcaattctcaaatacttttggaagaagaagaagaggc
atcgcgacatcgacgacgacgacatcatttcttgttgggcggcgaaattcgttacaaaac
gaattcgtttcaacgacctcttcgagaggtggaagtaaaagagcgttttcgtcgtccaat
gctaaaaataacggagtgaatcaaccgtttggcaaagagtacgaaatcatcgaccacgag
tacgacgccgtggtcgtcggcgctggcggtgcgggtttacgcgcggccatcggcttatcc
gaacacgggtacaaaaccgcgtgcgttacgaaactcttcccgacgcgatcgcacacggtg
gcggcgcaaggcgggatcaacgcggcgctcgggaacatgtccgaagacgattggagatgg
cacgcgtacgataccgtgaaaggtgcggattggttaggggaccaagatgctattcagtac
atgtgcagagaagcgccggaagcggtgagagagttggaacgatacggattgccgttttcg
agaacggaggaagggaagatttaccaaagagcgtttggaggacaaagtttggagtacggg
aaaggcggtcaggcgtacaggtgcgcgtgcgcggcagatagaactgggcacgcgatgttg
cacacgctatacgggcaagcgttgcgacacgagacgcagtttttcgtggagtatttcgcg
ctcgatttaatcatggacgaacaaggcgcgtgcgtcggcgttttggcgatgtgtttggaa
gatggtactttgcacaggtttaggtcgcacaagacgattttagcgaccggtgggtatgga
cgagcctacttctcggcgacgagcgcgcacacgtgcacgggagacgggaacgccatggct
gccagggctgggttgccgttgcaagatttggagtttgtgcagtttcacccgacgggtatc
tacggcgccgggtgtttaattaccgaaggttccagaggtgaaggcggtattttaagaaac
agcgaaggtgaaagattcatggaacgatacgcgccgtcggcgaaggatttagcgtccaga
gacgtcgtctcgagatcgatgacgatggaaattagagaaggacgaggcgtcgggaaagag
aaggatcacatttacttgcacttgaaccatttaccgccggaattgttagcggaacgattg
ccgggtatttccgaaaccgcggctatttttgccggcgtagacgtgaccaaagagccaatt
cccgtcattccaactgtacattataacatgggaggtatcccgacgaattataaaggcgaa
gtcgtcgcgccggccaaggacggaagcgatccggatcgagtcgtcccaggtttattggcc
gccggcgaagccgcgtgcgcttctgtccacggcgccaaccgattaggcgcgaactcgttg
ttggatatcgtcgtctttggccgcgcgtgcgcgaacacggtgaaagaatccggtttgaaa
cccggtcaaaaacataaacctttgaagaacgaactgaacggcgagcaaagcgtgaaacga
ttaaacgatattcgatacaacgataaaggcgctcaaaacaataaatcgacgagtgagtta
agaaaacgcatgcagcgagtcatgcaagacgacgcggcggtgtttagaacgcaagaaacg
ttagccgaagggtgcatgaaaatcgaccaagtcgcgaaagagatggaaagtttacatgtc
accgataagagtttagtttggaacacggatttagtcgaagcgttggagttgcacaacttg
atgccgaacgcgagaattaccatgcacggcgccgaacaaaggaaagaatcgagaggcgcg
cacgccagagaggatttcccggatagattggacgatacgtggatgaaacacacgctcggg
tacatcgaggaaaaagacgacagcgtgaaaatcgattaccgacccgtgcatcactacacc
ttagataaagaaatggacgtcattcctccgatgaaacgcgtttattaa

DBGET integrated database retrieval system