KEGG   Bathycoccus prasinos: Bathy09g02960Help
Entry
Bathy09g02960     CDS       T03089                                 

Definition
(RefSeq) hypothetical protein
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
bpg  Bathycoccus prasinos
Pathway
bpg00220  Arginine biosynthesis
bpg00250  Alanine, aspartate and glutamate metabolism
bpg00710  Carbon fixation in photosynthetic organisms
bpg01100  Metabolic pathways
bpg01200  Carbon metabolism
bpg01210  2-Oxocarboxylic acid metabolism
bpg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpg00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Bathy09g02960
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bathy09g02960
   00220 Arginine biosynthesis
    Bathy09g02960
Enzymes [BR:bpg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Bathy09g02960
Amino acid related enzymes [BR:bpg01007]
 Aminotransferase (transaminase)
  Class I
   Bathy09g02960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 VASP_tetra
Motif
Other DBs
NCBI-GeneID: 19013803
NCBI-ProteinID: XP_007510961
UniProt: K8FES7
LinkDB All DBs
Position
9:complement(538314..539756)
Genome map
AA seq 480 aa AA seqDB search
MVHPVNANTINQNVLTAEYAVRGPIVVRAGELALQLKKDPSSLPFEDIVLCNIGNPQSLG
QKPITFYRQIMAICDYPDLLDSPECSKIFPEDVIARSKEVLANTAGGTGAYTESKGLKYV
REQIATFLEKRDGHKADPEMIYTLDGASSGVNYMLTLLIRGKQDAMLVPIPQYPLYSAGL
ALYGGTLCPYYLKEENNWGLDVNEMRKEVQKAKKDGVEVRALVVINPGNPTGNSLSLENQ
QEVVKFCAEENLILLSDEVYQDNIYVEGKSFVSMKKVVADMGYGDKVALASLQSTSKGFY
GECGKRGGFMELYGAWDQGVLDQLLKLASINLCPNVSGQILIGQVCTPPVEGDASYALYE
KEKADILASLKRRSGKLVDGLNKLTGVTCNNSDGAMYAFPNLTFPEKFLKDCEGKGKMAD
AVYCMSILEETGIVVVPGSGFGQADGTWHFRTTFLPGEDKIDAVVERLSAFHENFMKKWM
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggtgcatccagtgaacgcaaacacgatcaaccagaacgtcctgaccgcggaatacgcg
gtcagaggccccatcgtggtgagagccggcgaactcgctttacagttgaagaaagacccg
tcttcgttgccgtttgaagatatcgtcctgtgcaacatcgggaacccgcaatcgctcggg
caaaaaccaatcacgttttatcgtcaaatcatggccatttgcgattacccagatttgtta
gactcgccggagtgctcgaagatttttccggaagatgtcatcgcgagatcgaaggaggtt
ttagcgaacacggctggagggacgggggcgtacacggagtcgaaagggttgaagtacgtg
agagagcaaatcgcgacgtttttggagaagagagacggacacaaagccgatccggagatg
atttatactttggatggagcttcctctggggtgaattacatgttaacgttactcattcgt
gggaagcaagacgcgatgttggtgccgattccgcagtatcctttgtattccgccgggttg
gcgttgtacggcggaaccttgtgcccgtattatttgaaagaggagaataactgggggttg
gacgtgaacgaaatgcgtaaagaggttcaaaaagccaagaaagacggggttgaagtcaga
gcgttggtggtgatcaatcccgggaatccaactgggaacagcttgtcgttggagaaccaa
caagaagttgtgaaattttgcgctgaggagaatttgattttgttgtccgacgaagtgtat
caagataacatttacgtggagggtaaatcattcgtcagcatgaagaaagtcgtggcggat
atgggatacggggataaagtcgcactcgcatcgttgcagtccacctcgaaaggtttctac
ggcgagtgcgggaagagaggcggatttatggaactctacggcgcctgggaccaaggcgtg
ttggatcagttgttaaagttggcgagtatcaacttgtgcccgaacgtgagtggacagatc
ttgattggccaagtgtgcacgcctccggtcgagggcgatgcatcgtacgcgttgtacgag
aaggagaaggcggacattttggcgagtttgaaaagacgctcggggaagttggttgacggt
ttgaacaagttgaccggcgtgacgtgtaacaacagcgacggggcgatgtacgcgtttccg
aatttaacttttccggagaagtttctcaaagactgcgaaggtaaaggaaagatggcagat
gccgtgtattgcatgagtatcttggaagaaaccggtattgtcgtcgttcctgggtctgga
tttggccaagccgacgggacgtggcacttccgaacgacgtttttgcccggggaggataaa
atcgatgccgtcgtcgaaagattgagcgcgttccacgagaatttcatgaaaaagtggatg
taa

DBGET integrated database retrieval system