KEGG   Bathycoccus prasinos: Bathy11g00330Help
Entry
Bathy11g00330     CDS       T03089                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
bpg  Bathycoccus prasinos
Pathway
bpg03030  DNA replication
bpg03410  Base excision repair
bpg03420  Nucleotide excision repair
bpg03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bpg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Bathy11g00330
   03410 Base excision repair
    Bathy11g00330
   03420 Nucleotide excision repair
    Bathy11g00330
   03430 Mismatch repair
    Bathy11g00330
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bpg03032]
    Bathy11g00330
   03400 DNA repair and recombination proteins [BR:bpg03400]
    Bathy11g00330
Enzymes [BR:bpg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Bathy11g00330
    6.5.1.6  DNA ligase (ATP or NAD+)
     Bathy11g00330
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Bathy11g00330
DNA replication proteins [BR:bpg03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Bathy11g00330
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Bathy11g00330
DNA repair and recombination proteins [BR:bpg03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Bathy11g00330
   NER (nucleotide excision repair)
    Other NER factors
     Bathy11g00330
   MMR (mismatch excision repair)
    Other MMR factors
     Bathy11g00330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 19012719
NCBI-ProteinID: XP_007510323
UniProt: K8FAM2
LinkDB All DBs
Position
11:53559..56111
Genome map
AA seq 850 aa AA seqDB search
MSSVPPTSAKKQSSLAGFFEKRKAQSSEDGAEAREDDDAREEVGNQKEQQQTTETTTTAT
TENNSPTQQKENIEVAAKKRKLVKKSEVLDANAKALSFAEQAKLKLEQKQQQPKTSAALK
QTEEKEEDEKDAKKNISVANVSDEKDEEYKASRESDDEEEEDEEGEEEDDDDEIEDVEGP
LSASVQKKAKKKTKSKNGKEKSEAGVGALQVELAQKYIDQSSESISSWKENTATPFGIVA
DTFESIAETTKRLEITNLLTNTFRSIIRGGLSGDLLAAVYLASNTIAPQHDGIDLGIGDA
TLIKCLAEATGRKEANIKADYREAGDLGSVAMASRSTQRTMFQPAPLTVKGVLQEFRVIA
TTAGTNSVDQKKGRIKKLLVAAKGSEAGYIVRALQGKLRIGLAQQTVNAALTHAIVLEAN
KTAGIKLGANALADQLLKAVDVVKLVFSECPSYDLVVPALLDVGIDGLQEKCQFKPGAPV
KPMLAKPTTGVAEVLNRFSDVEFTCEYKYDGERAQVHLLEDGSIKIFSRNQEDNTPKFPD
IVSKFKNYLNNVDGKITSVVIDCEAVAYDREQDKILPFQILSTRGKKNIKIEDVKVQVAL
YAFDCLYLNGKSLLREPMSVRRLALYSSFRETKGEFLFATAKTSRDVEELQVFLDESIAA
NTEGLIVKTMDATYEPSKRSLNWLKLKKDYMEGCGDSLDLVPIGAWHGRGKRTGVYGAFL
LACYDEDGEEFQTICKIGTGFSEIDLETLSKALEPHLIEAPRSYYKYPEGMEPDLWFDAK
LVWEVKAADLSISPTHKAAMGLVDPNKGIALRFPRFLRSRDDKEPEMATNAHQVADFYNA
QANKQTFEKE
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccgttccgcccacatccgctaagaaacagagttctttggcaggatttttcgag
aagaggaaggctcagtcctccgaagatggcgccgaagcgcgcgaagacgacgacgctcga
gaggaagtaggaaatcagaaagaacaacaacagacgacggaaacgacgaccacggcgacg
acagagaacaattcgcctacgcaacagaaagaaaacatcgaagttgccgcgaagaagcgc
aaactagtgaagaaatccgaagttctcgacgcaaacgcgaaagcattgtcctttgcagaa
caagcaaagttgaaattggaacaaaagcagcaacaaccaaaaacatcagcagcacttaag
caaacggaggaaaaagaagaagatgagaaagatgcaaagaagaacatcagcgttgccaac
gtgagcgatgaaaaggatgaagaatacaaagcatcgcgtgaatctgatgacgaagaagaa
gaagatgaagagggggaggaggaagacgatgatgatgaaatcgaagacgtcgaaggccca
ctttctgcttctgttcaaaaaaaagcgaagaagaaaacaaagtcaaaaaatgggaaggaa
aaatctgaagccggcgttggagccttacaagttgaacttgcacagaagtatatcgaccaa
tcatcggaatcgatctcatcttggaaggagaatacggcaacaccatttggaatcgttgcg
gatacgtttgaaagtattgccgagacaacgaaacgattggagatcacgaacttgttgacg
aatacattcagatctattattcgtggtgggttatctggagatttgctcgcagcagtttac
ttggcttcaaacacgatcgcgccgcaacacgatggtattgatctcggtataggagatgcg
actttgattaaatgtctggccgaagcaactgggcgcaaagaggcaaacataaaggctgac
taccgcgaggctggcgacttgggttctgttgccatggcatcccgatcgacgcaacggaca
atgttccagcccgcaccgttaacggtgaaaggcgtcttacaggagttccgcgtcatagct
actacagcaggaacgaattcagtcgatcaaaagaagggacgaattaagaaattactcgtt
gccgccaaaggcagcgaagctggatacatagtgagggcattacaaggaaagttacgcatt
ggtctggctcagcaaaccgtgaacgctgctcttacgcatgctatcgttttagaagcaaat
aaaactgcaggtataaagctaggtgctaatgccttggcagatcaactcctgaaagccgtg
gatgttgtgaagcttgttttctcggaatgtccgagctacgacttggttgtcccagcgctc
ttggatgttggcatcgacggtctgcaggagaaatgtcaatttaaaccaggtgcgccagtg
aaaccaatgttggcaaagccaacgaccggtgtggcggaagttttgaacagattttctgac
gttgaatttacgtgcgaatataagtatgacggcgagcgagctcaagtgcacttgctcgaa
gatggatcgataaagatcttctccagaaatcaggaagataacacgccaaagttccctgat
atcgtttcgaaattcaaaaattacttgaacaacgtagacgggaaaataacctcagtagtc
atcgattgtgaagccgtggcgtacgatagagagcaagataagattcttccttttcagatt
ttgagtactagaggaaagaaaaatatcaaaattgaagacgttaaagtgcaagtggcgttg
tacgcatttgattgtttatatttgaacggaaaatcgctcttgcgtgaaccgatgagcgtt
aggcgtcttgcgctttatagttcattccgagaaacgaaaggtgaattcctgtttgccact
gcaaaaacgagcagggatgtggaggagctgcaggtatttttggatgaatccatcgctgcg
aataccgaaggtttgattgtaaagacaatggatgctacatacgaaccctccaagcgctca
ttaaactggttgaagttgaagaaagactacatggaaggatgcggagactcgttagatttg
gtcccaatcggtgcttggcatggcagaggcaaaaggacaggggtgtatggagcatttctt
ctcgcttgttacgacgaagatggagaagagtttcaaacgatttgcaaaattggaactggc
ttttccgagatcgatttggaaaccttgtcgaaagcgcttgaaccgcatttaatagaagct
ccacgctcttactacaaatatcctgaaggtatggaacctgacttatggtttgacgcaaag
ttagtttgggaagtgaaagcggctgatctgtcgatctctccaacgcacaaagctgccatg
ggtttagtggatccaaacaagggtattgctttacgttttccgcgctttttaagaagtcga
gacgataaagagccggaaatggcgactaacgcgcatcaagttgcagatttttacaatgct
caggcaaataagcaaacttttgagaaggaataa

DBGET integrated database retrieval system