KEGG   Bathycoccus prasinos: Bathy15g00500Help
Entry
Bathy15g00500     CDS       T03089                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bpg  Bathycoccus prasinos
Pathway
bpg04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:bpg00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Bathy15g00500
Enzymes [BR:bpg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Bathy15g00500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu DUF5114
Motif
Other DBs
NCBI-GeneID: 19011539
NCBI-ProteinID: XP_007508895
UniProt: K8EPK1
LinkDB All DBs
Position
15:complement(join(84684..84717,84765..85204,85391..85543))
Genome map
AA seq 208 aa AA seqDB search
MNALLTARIIDSLFTREYNDNIINNNNIHRLKTVSKAARKTPVAFAVNAEQKAVVVLTGT
AGVAGTLTLTQDDPSGATTVVGDITGLAPGKHGLHVHEFGDTTNGCMSTGPHFNPNKMTH
GAPTDSVRHAGDLGNVIADAGGCKFTIKDMQIPLSGANSIVGRAFVIHELEDDLGKGDNS
EIGTQGKTSSTTGNAGARLACGVVGLTP
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctctgttaaccgcacgtattatcgactctctcttcacgcgcgaatataatgat
aacattattaacaacaacaatatacacaggttgaaaacggtttctaaagccgcgagaaag
accccggtcgcgttcgccgtcaacgccgaacaaaaagcggtcgtcgttctcaccggtacg
gctggcgtcgcgggcacgttaactttgacgcaagatgacccgtctggcgcgacgacggtt
gtcggcgacatcaccggtttggcgccgggcaaacacggtttgcacgtgcacgaattcgga
gacacgaccaacgggtgcatgtccactggtccgcactttaacccgaacaagatgacgcac
ggcgcgccgacggattcagtcagacacgccggggatttgggtaacgtcatcgcggatgcc
ggcgggtgcaagtttaccattaaggatatgcaaattcctttgtccggggcaaactccatc
gtcggcagagcgttcgtgattcacgagttggaagatgatttgggtaaaggggataactcg
gaaatcggcacgcaaggcaagacgagttccacgaccggtaacgcgggcgcaaggttggcc
tgcggcgtcgtgggtttaactccctaa

DBGET integrated database retrieval system