KEGG   Paraburkholderia phymatum: Bphy_0010Help
Entry
Bphy_0010         CDS       T00704                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00010  Glycolysis / Gluconeogenesis
bph00620  Pyruvate metabolism
bph01100  Metabolic pathways
bph01110  Biosynthesis of secondary metabolites
bph01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bphy_0010
   00620 Pyruvate metabolism
    Bphy_0010
Enzymes [BR:bph01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Bphy_0010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ACC69206
UniProt: B2JJA5
LinkDB All DBs
Position
1:complement(11514..13034)
Genome map
AA seq 506 aa AA seqDB search
MNHAEMKFLTTEFPYKKQYANFIGGEWVKPTGGEYFDNISPITGEPFTSIPRSREADIEL
ALDAAHRARAAWGKTSTTDRANILNKIADRLEANLQRLAVAESIDNGKPLRETMAADIPL
AIDHFRYFAGAVRAQEGGISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAAWKLAPALA
AGNCVVMKPAEQTPASLLVLAELIQDLLPPGVLNIVNGFGLEAGKPLASNKRIAKIAFTG
ETTTGRLIMQYASQNIIPVTLELGGKSPNIFFADVLDKDDSFFDKALEGFAMFALNQGEV
CTCPSRVLIEESIYDRFMERALKRVAAIQQGHPLDTKTMIGAQASREQLEKILSYIDLGK
QEGAQCLIGGEQNKLDGELSKGYYVKPTVFRGHNKMRIFQEEIFGPVVSVTTFKTEEEAL
EIANDTLYGLGAGVWTRDGTRAYRFGREIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSEKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgcagagatgaagtttctgacgaccgagtttccgtacaagaagcaatacgcg
aatttcatcggcggcgaatgggtcaagccgactggcggcgaatacttcgacaacatctcg
ccgatcacgggcgaaccgttcacgtcgattccgcgctcgcgcgaagcggacattgaactc
gcgcttgacgccgcgcatcgcgcgagggccgcatggggcaagacctccaccacggaccga
gcgaacattcttaacaagatcgccgaccgcctcgaagcgaacctgcaacgcctcgccgtc
gccgaatcgatcgacaacggcaagccgctgcgcgaaacgatggcggccgacatccccctc
gcaatcgaccacttccgttatttcgcgggcgccgtgcgcgcgcaggaaggcggcatctcg
gagatcgaccacgatacagtcgcgtatcactttcatgagccgctcggcgtggtcggtcag
atcattccgtggaatttcccgatcctgatggctgcgtggaaactcgcgcctgcactggca
gcgggcaattgcgtcgtgatgaagcctgccgaacagacgcccgcctcgctgctcgtgctc
gcggagctgattcaggacctgctgccgccgggcgtgctgaacatcgtcaacggtttcggt
ctcgaagcaggcaagccgctcgcctcgaacaagcgcatcgcgaagatcgccttcacgggt
gaaacgacgacgggccggctcatcatgcagtacgccagccagaacatcattcccgtgaca
ctggaactgggcggcaagagtccgaacatcttcttcgccgacgtgctcgacaaggacgat
agcttcttcgacaaggcgctcgaaggctttgcgatgttcgcgctgaaccagggcgaagtt
tgcacgtgtccgtcgcgcgtgctgatcgaagagtcgatttacgaccgtttcatggagcgc
gcgctgaagcgtgtcgcagccattcaacagggccacccgctcgacacgaagacgatgatc
ggcgcgcaggcctcccgggaacagctggaaaagatcctgtcgtacatcgatctcggcaag
caggaaggcgcgcaatgcctgatcggcggcgagcagaacaagctcgacggcgagctatcg
aagggctactacgtgaaaccgaccgtgttccgcggccacaacaagatgcgcatctttcag
gaagaaatcttcgggccggtagtgtccgtcacgacgttcaagacggaagaagaagcgctc
gaaatcgccaatgacacgctgtacggactcggcgcaggcgtctggacccgcgacggcacg
cgcgcgtatcgcttcggccgcgagatccaggcgggccgcgtgtggacgaactgctaccac
gcatatccggcgcatgcggccttcggcggctacaagcagtcgggcatcgggcgcgagaac
cacaagatgatgctcgaccactatcagcagacgaaaaatctgctcgtcagctatagcgag
aaacctttgggcttcttctga

DBGET integrated database retrieval system