KEGG   Paraburkholderia phymatum: Bphy_0054Help
Entry
Bphy_0054         CDS       T00704                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00970  Aminoacyl-tRNA biosynthesis
bph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bph00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Bphy_0054
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bph03029]
    Bphy_0054
Enzymes [BR:bph01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Bphy_0054
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Bphy_0054
Mitochondrial biogenesis [BR:bph03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Bphy_0054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ACC69249
UniProt: B2JJW2
LinkDB All DBs
Position
1:62165..63658
Genome map
AA seq 497 aa AA seqDB search
MHEKSLTELRAALDAKQCSAVELAQTYLKRIEDRKALNAFVHVDAQQTLAQAQAADALIA
AGNAGPLTGLPIAHKDVFVTRNWRSTAGSKMLENYTSPFDATVVDRLAQAGMVCVGKTNM
DEFAMGSSNENSYFGPVQNPWDRKAVPGGSSGGSAAAVAARLAPAATGTDTGGSIRQPAS
FSGITGIKPTYGRVSRYGMIAFASSLDQGGPMAQTAADCALLLNAMGGFDERDSTSLTHD
HEDYTRYLGQDWSGAGNARDKPLAGLRVGLPKEYFGAGLADDVRASIDAALKQYEALGAT
LVEVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRYGHRAAEYRDLLDMYKKSRAEGFGP
EVKRRILVGTYVLSHGYYDAYYLQAQKIRRIIAQDFQEAFRHCDVIMGPVAPSVAWDIGA
KGDDPVQMYLADIYTLSVSLAGLPGMSVPCGFGAGANAQRPVGLQIIGNYFNEARMLQVA
DAFQRATDWHRMAPAGV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgcatgagaaaagcttgaccgaactgcgcgccgcgctcgacgcgaagcagtgctccgca
gtcgaactggcgcagacgtatctgaagcggatcgaagaccgcaaggcgctgaacgcgttc
gttcacgtcgacgcgcagcagacgctcgcgcaggcgcaagccgccgacgcgctgatcgcg
gccggcaacgccggtccgctgacgggtttgcccatcgcgcataaagacgtgttcgttaca
cgcaactggcgttccacggccggctcgaagatgctcgaaaactacacgagcccgttcgat
gccaccgtcgtcgaccgtctcgcgcaggcgggcatggtgtgcgtcggcaagaccaacatg
gacgagttcgcgatgggctcgtcgaacgaaaactcgtatttcggcccggtgcagaacccg
tgggaccgcaaggcggtgccgggcggctcgtcgggcggttcggcggcggctgtcgccgcg
cgcctcgcgcccgccgcgacgggcaccgacacgggcggatcgatccgtcagcccgcgtcg
ttctcgggtatcacgggcatcaaaccgacgtacggccgcgtatcgcgctatgggatgatc
gcgttcgcatcgtcgctcgatcagggcggcccgatggcgcagacggccgcggactgcgcg
ctgctgctcaacgccatgggcggcttcgacgagcgcgattcgacgagcctcacgcacgat
cacgaagactacacgcgctatctcggccaggactggtcgggcgcgggcaatgcgcgcgac
aagccgctcgcgggtctgcgggtcggcttgccgaaggaatacttcggcgcaggtctggcc
gacgacgtgcgcgcatcgatcgacgccgcgctgaagcaatacgaagcgcttggcgcaacg
ctcgtcgaggtgtcgctgcccaagaccgagctgtcgattcccgtgtattacgtgatcgcg
ccggcggaagcatcgtccaacctgtcgcggttcgacggcgtgcgctacggccaccgcgcg
gcggagtatcgcgatctgctcgacatgtacaagaagtcgcgcgcagagggtttcggcccc
gaagtgaagcgtcgcattctggtcggcacgtatgtgctgtcgcacggctactacgacgcg
tactacctgcaggcgcagaagatccgccgcatcatcgcgcaggatttccaggaagcgttc
aggcattgcgacgtgatcatgggcccggtggcgccgtcggtcgcgtgggatatcggtgcg
aagggcgacgaccccgtgcagatgtacctcgcggacatctacacgctgtcggtgagcctt
gccggtttgcccggcatgagcgtaccttgcggcttcggcgcaggcgcgaatgcgcagcgt
ccggtcggcttgcagatcatcggcaactatttcaacgaagcacgcatgctgcaagtggcc
gacgcgttccagcgcgccaccgactggcatcgcatggcgccggcgggagtctga

DBGET integrated database retrieval system