KEGG   Paraburkholderia phymatum: Bphy_0981Help
Entry
Bphy_0981         CDS       T00704                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bph  Paraburkholderia phymatum
Pathway
bph03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bph00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Bphy_0981
Enzymes [BR:bph01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Bphy_0981
DNA repair and recombination proteins [BR:bph03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Bphy_0981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ACC70170
UniProt: B2JG88
LinkDB All DBs
Position
1:1096745..1099609
Genome map
AA seq 954 aa AA seqDB search
MTDKLETYHRKRRFNETPEPSGVATRGNGRQAAKPAPPGKAARQHDLSFVIQEHDARRLH
YDFRLELDGTLKSWAVPKGPSLDPSVKRLAVHVEDHPIEYGSFEGDIPEGNYGAGSVIVW
DRGTWEPVGGEAGARDAYAAGKLKFHLKGHKLHGGWTLVRSHMRGSGDKEQWLLIKERDD
EARSEADFDVLEQRQGSVLSDAPGARGGAKGAARPVAGKWKTREERANASVRASKAAASR
RAKGTPDDRPDIVATRNSQSLRELAQHPSIEGAVEAKLPAALKPQLATLVDSAPAGDDWL
YEIKFDGYRILARIDHASKEPVKIFTRAGNDWSAKFGKQVKAIARVGVGSAWLDGEAVVL
DSHGVPDFQALQNAFDANRPQDITLYLFDLPYLNGYDLRGVPLEQRRAILRALLDTVDDD
TLRFSSDFGFDADQLLKSACDMQLEGIIGKRRDSLYVSGRSPAWIKLKCRRRQEFVIGGY
TEPAGSREAFGALLLGVYDAKGQLQYAGRVGTGFDASRLRSIKKELDGRETATMPFASEP
RERSRTRVHWVKPELVAECNFAEWTSDGVVRQASFVSLRSDKPAQQIVHEAPRKGADVQH
IAEESGAGQTKTSTAKQRVSKMPDVRDAPKTTTKRAGASSTSVGSAAAKSSGKTGAATVS
GVRISHPDRVIDKSTGVRKLELAEYYASVATWMLPYLKDRPVALVRAPEDIGGELFFQKH
SQRLAIPNITQHPGLDPGHPPLLTIESEAALVGAAQMGTIELHTWNAVAANIEKPDRMVF
DLDPDPALGWKRMIEAAQLTRELLAELGLESFCKTSGGKGLHVVVPIAKQLGWDDVKVFS
QAVAQHMATALPKHFAAKMGAQNRKGKIFVDYLRNNRGSSTVCAYSLRARPGLGVSVPLT
WDEVPETTAGDQWNIANVHERLDALKRDPWADYAKTRQRITAAMRRRLDTAERD
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagctcgagacctatcatcgcaagcgacgcttcaatgaaacgccagagccg
tcgggcgttgccacacgcggaaacggcaggcaggccgccaagccggcgcccccgggaaaa
gcagccaggcagcacgacctgtcgttcgtgatccaggagcacgacgcgcggcgtctgcac
tacgacttccgtctcgaactcgacggtaccttgaagtcatgggcggtgccgaaggggccg
agcctcgatccatcggtcaaacggctcgcggtgcatgtcgaagatcatcccatcgaatac
ggctcgttcgagggcgacattcccgagggtaattacggcgcgggttccgtgatcgtctgg
gatcgcggcacatgggaacccgtcggcggcgaagcgggcgcgcgcgacgcgtacgcggcg
ggcaagctcaagtttcatctgaagggtcacaagctgcacggcggctggacgctcgtgcgc
agccatatgcgcggcagcggcgacaaggagcaatggctgctcatcaaggagcgcgatgac
gaggcgcgcagcgaagccgacttcgacgtgctcgaacagcggcagggcagcgtgctgtcg
gatgcaccgggcgcgcgcggcggtgcaaaaggagcggcccgacccgtcgccggcaaatgg
aagaccagggaagagcgtgcgaacgcgtcggtcagggcgtcgaaggcggcggcgtcacgc
agggccaaaggcacgcccgacgatcgccccgacatcgtcgcgacgcgcaactcgcagtcg
ctgcgagaactcgcgcagcatccgtcgatcgaaggcgcggtcgaggcgaagctgcctgcc
gcgctcaagccgcagctcgcgacgctcgtcgacagcgcgccggccggcgacgactggctt
tacgagatcaagttcgacggctaccgcatcctggcgcgcatcgatcacgcatcgaaggag
cccgtgaagattttcacgcgtgcgggcaacgactggagcgcgaagttcggcaagcaggtg
aaggcgattgcgcgcgtcggtgtgggcagcgcgtggctcgacggcgaagcggtggtgctc
gacagccacggcgtgccggatttccaggcgctgcaaaatgccttcgatgcgaaccgtccg
caagacatcacgctctatctgttcgacttaccgtatctcaacggctacgacttgcgcggc
gtgccgctcgaacagcgtcgcgcgatcctgcgcgcgctgctcgacaccgtcgacgacgac
acattgcgcttctcgtccgacttcggcttcgacgccgatcagttgctgaagagcgcatgc
gacatgcagctggaaggcatcatcggcaagcgccgcgacagcctgtatgtgtcgggccgc
tcgcccgcgtggatcaagctcaagtgccggcgccggcaggagttcgtgatcggcggctat
acggaaccggcgggcagccgcgaggcgttcggcgcgctgctgctcggtgtatatgacgcg
aagggacagctgcaatacgcggggcgagtcggcacgggtttcgatgcaagccggttgcgc
tccatcaagaaggaactggacgggcgcgaaacggcgacgatgccgttcgcgagcgagccg
cgcgaacgaagccgcacgcgcgtgcattgggtgaagcccgaactcgtcgcagaatgcaac
ttcgcggaatggacgagcgacggcgtcgtgcggcaggcgtcgttcgtcagtctgcgcagc
gacaagcccgcgcaacagatcgtccatgaagcgccacgcaagggggctgacgtgcaacat
atcgcggaagaatcgggtgccgggcagacgaagacgtcgacggcgaaacagcgggtgtcg
aagatgccggatgttcgggacgcgcccaagaccacaacgaagcgcgcgggcgcgtcttca
accagcgtcggcagtgccgccgcgaaatcgtccggcaagacgggtgcggcgaccgtctct
ggcgtacgcatctcgcatcccgaccgcgtaatcgacaagagcaccggcgtgcgcaagctc
gaactcgctgaatactacgcatcggttgcgacgtggatgcttccgtatctgaaggaccgc
cccgttgcgctcgtgcgagcgccggaggacatcggcggcgagctgttcttccagaagcac
agccagaggctcgcgatcccgaacatcacgcagcatcccggactggaccccggtcatccg
ccgctgctgacgatcgagagcgaagcggcgctggtcggcgcagcgcagatgggcacgatc
gaactgcacacgtggaacgcggtggccgcgaacatcgagaagccggaccgcatggtgttc
gatctcgacccggacccggcgctcggctggaagcggatgatcgaagcagcgcagctcacg
cgcgagctgctcgccgaactaggccttgagtcgttttgcaagacgagcggcggcaagggg
ctgcacgtcgtcgtgccgatcgcgaagcagctgggctgggacgacgtgaaggtgttttcg
caagccgtcgcgcagcatatggcgaccgcgctgccgaaacacttcgctgcgaagatgggc
gcgcagaaccgcaagggcaagattttcgtcgactatctgcgcaacaaccgcggttcgagc
accgtctgcgcgtactcgctacgcgcgcgtcctggcctgggggtgtcggtaccgctcacg
tgggatgaagtgcccgagaccacggcaggcgatcaatggaacatcgcgaacgtccatgag
cggctcgacgcgctgaagcgcgatccgtgggccgattacgcgaagacccggcagcgcatc
acagccgccatgcggcgcaggctcgatacggcggaacgcgattga

DBGET integrated database retrieval system