KEGG   Paraburkholderia phymatum: Bphy_2671Help
Entry
Bphy_2671         CDS       T00704                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00473  D-Alanine metabolism
bph00550  Peptidoglycan biosynthesis
bph01100  Metabolic pathways
bph01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bph00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Bphy_2671
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bphy_2671
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Bphy_2671
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bph01011]
    Bphy_2671
Enzymes [BR:bph01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Bphy_2671
Peptidoglycan biosynthesis and degradation proteins [BR:bph01011]
 Precursor biosynthesis
  Amino acid ligase
   Bphy_2671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_ST ATP-grasp ATP-grasp_4 TTL ATPgrasp_YheCD PPR BMC
Motif
Other DBs
NCBI-ProteinID: ACC71843
UniProt: B2JHF8
LinkDB All DBs
Position
1:complement(3012766..3013707)
Genome map
AA seq 313 aa AA seqDB search
MSGIDPKSFGKVAVLLGGASAEREVSLNSGRLVLQGLRDAGVDAYAFDPAERPLAALKDE
GFVRAFNALHGGYGENGQIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQLGIPTPP
FEAVLRGDDYAARAQGIVAKLGLPLFVKPASEGSSVAVIKVKTADALVPALEEAVKFDKI
VVVEKSIEGGGEYTACIAGDLDLPIIRIVPAGEFYDYHAKYIANDTQYMIPCGIAAEEEA
RLKKLARQAFDVLGCTDWGRADFMLDGEGNAYFLEVNTAPGMTDHSLPPKAARAVGISYQ
ELVVKVLALTLKD
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtatcgatcctaaatctttcggcaaggttgccgtgctgctcggcggtgcgtcc
gccgagcgcgaagtgtcgctgaactccggccgtctcgtgctgcaaggcctgcgcgatgca
ggcgtcgacgcgtatgcgttcgatcccgccgagcgtccgctcgcggcattgaaggatgaa
ggcttcgtgcgcgcgttcaacgcgctgcacggcggctatggcgagaacggccagattcag
ggcgcgctcgatttctacggtatccgttatacgggcagcggcgtcctcggctcggcgctc
ggtctcgacaagttccgcaccaagctcgtgtggcagcagctcggcattccgacgccgccg
ttcgaagccgtgctgcgcggcgacgactacgccgcgcgcgcgcagggcatcgtcgcgaag
ctcggcttgccgctcttcgtgaagccggccagcgaagggtcgagcgttgccgtcatcaag
gtgaagacggccgacgcgctcgtgcccgcgctcgaagaagcggtgaagttcgacaagatc
gtcgtagtggaaaagagcatcgaaggcggcggcgagtacacggcgtgcatcgcgggcgat
ctcgatctgcccatcatccgcatcgtgcccgccggcgagttctacgactatcacgcgaag
tacatcgcgaacgacacgcagtacatgattccgtgcggcatcgcggctgaagaagaagcg
cgcctgaagaagctcgcgcgccaggcgttcgacgtgctcggctgcaccgactggggtcgt
gccgacttcatgctggacggagaaggcaacgcatattttctcgaagtgaacacggcgccc
ggcatgacggatcattcgctgccgccgaaggcagcgcgtgctgtcggcatcagctaccag
gaactggtggtgaaggtgctcgcgctgacgctgaaggattaa

DBGET integrated database retrieval system