KEGG   Paraburkholderia phymatum: Bphy_3198Help
Entry
Bphy_3198         CDS       T00704                                 

Definition
(GenBank) Aldehyde Dehydrogenase
Organism
bph  Paraburkholderia phymatum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACC72358
UniProt: B2JRN1
LinkDB All DBs
Position
2:complement(108869..110365)
Genome map
AA seq 498 aa AA seqDB search
MTTSRFDPQAELSDDVRSRFYIGGHWVLPNSKETASLVSPTTEKSFLSVPLADRRDVDDA
VRAARKAFDTGPWPLMSAAERSDYLRRLSGAVASRMQLLSRLWTAEVGAPVWFADLFTPT
ATAMLEYYAELSLSFPFKEHRQTRGGHARVLRQPVGVTALIAPWNAQLPILAYKLSAALA
AGCTVVVKAPPETPLDALVLAECAHEVDLPPGVLNVITADADRGAHLVANVAVDKVSFTG
STATGKVIAKTCADRLARVTLELGGKSAAIILEDAELEPTLASLSPYTMPFSGQICFAQT
RILVPRNREQEIVEAYSAVIGGLNVGDPWDETTQIGPLANRRQFDRVLRYIDVGRSEGAR
LATGGKSCERFERGYFVEPTIFSGVTPDMTIAREEIFGPVVTVTAYDDVDHAIALANDSD
FGLSGTVFTTDVERGYDVARQLKTGNVSVNGLEMSPNVPFGGFKQSGVGREGGPEGLSAF
LEDQAIYLPSEAQPSKLA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaccacttcgcggtttgatccacaagctgagttgagtgacgacgtgcggtcccgtttt
tatattggaggacattgggtactgccgaattcgaaggaaacagcatcgcttgtgtcacca
acgacggagaaatcgtttctttccgttcctctcgctgatcggcgggacgtggatgacgcg
gtccgagcggccagaaaggcctttgatacgggaccatggccacttatgtccgcggcggag
cgctctgattacttgcgacgcttgtcgggcgctgtggcgtcgcgcatgcaactgctgtcc
cggctgtggacggcggaggtcggcgcgcctgtctggttcgcagacctgttcactcctact
gcgactgcgatgctcgaatactacgcggagctgtccctatcctttccgtttaaggaacat
cgtcaaacgcgaggagggcacgcgcgagttctccggcaaccggttggggtaaccgccttg
atcgcgccatggaacgcacaattgccaatcctggcgtacaagttgagcgctgcccttgcc
gccgggtgcaccgtggttgtcaaggcacctcccgagacccctcttgatgcgttagtgctg
gcggaatgcgcacatgaagtagatttgccgccgggtgttctcaatgtgattacggcagac
gcagatcgtggcgctcatctggtggcgaatgtcgcggtcgacaaggtcagcttcactggc
agcactgcaaccgggaaagtgatcgccaaaacctgtgccgatcgactcgcacgagtcacg
ctggaactcggtgggaagtccgcagcaatcattctcgaagacgcagaactcgaaccgacg
ctcgcctcgttgtctccgtacaccatgcctttttccgggcagatctgtttcgctcaaacc
cgtattctggttccgcgcaatcgagagcaagaaattgtcgaggcttatagtgccgtaatc
ggtggactgaacgtaggagatccatgggatgagaccacacaaatcggcccactcgcgaat
cgtcgccagttcgatcgggtccttcggtacatcgatgttggacgtagcgaaggagcgcga
ttagccacaggaggaaagagctgtgagcgcttcgaaaggggctattttgtcgagcccacc
atcttttcgggtgtaacacctgatatgacaattgcgcgcgaagagatatttggcccggtc
gtcactgtaaccgcgtacgacgatgtcgatcacgctatcgcacttgcaaacgattcagat
tttgggttaagcgggaccgtgttcacgacagatgtagaacggggctacgacgtcgcgcgg
cagctcaagaccgggaacgtctcggtaaacggcttggaaatgtcgccgaacgtacccttc
gggggattcaagcagtcgggggttggtcgagaaggtggtccggaaggtctaagcgcattc
cttgaggatcaggcgatttaccttccatccgaagcgcaaccttcgaaactggcatag

DBGET integrated database retrieval system