KEGG   Paraburkholderia phymatum: Bphy_3656Help
Entry
Bphy_3656         CDS       T00704                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bph  Paraburkholderia phymatum
Brite
KEGG Orthology (KO) [BR:bph00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bphy_3656
Enzymes [BR:bph01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Bphy_3656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 Thi4 K_oxygenase FAD_oxidored HI0933_like FAD_binding_3 DAO FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ACC72791
UniProt: B2JMJ7
LinkDB All DBs
Position
2:complement(608315..609907)
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLKAYLEKVSRPIEIVASLDDGTKSQELLALLNDIASLSERVNVIERRGDDE
RKPSFSIGEPGKTTGIRFAGIPMGHEFTSLVLALLQTGGHPIKLDDAVIQQIRELDGDFA
FETYFSLSCQNCPEVVQALNIMALINPRIRHTAIDGALFQNEVESRQIMAVPTMFLNGEV
FGQGRSGVKEILAKLDSNAGARAAKELEKKPVFDMLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTLAIENFVSVQETEGPKFATALEQHVKSYEVDVMDVQRAEALIPGKINE
VRLAGGAVLKAKTIVLATGARWREINVPGEREYRNHGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGVVNHVTLIEFGATLRADEVLQRKLRSLPNVVVITQAQTTEITGDGKKV
NGLTYTDRVSGESKHVELEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDAKGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLAAFDHLIRTSVEDAEDAQAAAMAEV
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcgaatctgaagacccaactcaaagcctacctcgagaaagtcagtcgtcct
atcgagatcgtcgcttcgctcgacgacggcacgaagtcgcaggagctactggcgctgctg
aacgacattgcgtcgctgtcggaacgtgtgaatgtgatcgaacgtcgtggcgatgacgag
cgcaagccgtcgttttcgatcggcgagccgggcaagacgacgggcatccgcttcgcaggc
attccgatggggcatgaattcacgtcgctggttctcgcactgctgcagacgggcggccac
ccgatcaaactcgacgacgcggtgatccagcagattcgcgaactcgacggcgacttcgcg
ttcgaaacttacttctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctcaac
atcatggcgctgatcaatccgcgcatccgccacacggcgatcgacggcgcgctgttccag
aatgaggtcgagtcgcgccagatcatggccgtgccgacgatgttcctgaatggcgaagtg
ttcggtcagggccgcagcggtgtgaaggaaatccttgcgaagctggatagcaacgccggc
gcgcgcgccgcgaaggaactggagaagaagccagtgttcgacatgctgatcgtcggcggc
ggtcccgctggcgcggcggccgcgatttactcggcgcgcaaaggcattgcgacgggcgtg
gtcgcggaacgcttcggcggccaggtgctggatacgctggcgatcgaaaacttcgtgtcg
gtgcaggaaacagaagggccgaagttcgccacggcgctcgagcagcacgtgaagagctac
gaagtcgatgtgatggacgtgcagcgcgccgaagcgctgattcccggcaagatcaacgaa
gtgcgcctcgcgggcggcgccgtgctgaaggcgaagacgatcgtgctggcaacgggcgcg
cgctggcgcgagatcaacgtgccgggcgagcgcgagtaccgcaatcacggtgtcgcgtac
tgcccgcactgcgatggcccgctgttcaagggcaagcgcgtggccgtcgtcggcggcggc
aactcgggcgtcgaggcggcgatcgatctggccggtgtcgtgaatcacgtgacgctgatc
gaattcggcgccaccctgcgcgccgacgaagtgctgcaacgcaagctgcgcagcctgccg
aacgtcgtcgtgatcacgcaggcacagacgacggagatcacgggcgacggcaagaaggtc
aatggcttgacgtacacggatcgcgtgtcgggcgagtcgaagcatgttgaactcgaaggt
gtgttcgtgcagatcggtctcgtgccgaataccgaatggctgaagggcacggtcgaactg
tcgaagcacggcgagatcgtggtcgatgccaagggcgcgacctcggtgccaggcgtattc
gcggcgggcgacgtgacgacggtgccgttcaagcagatcgtgatcgccgtgggcgagggc
gcgaaggcatcactggccgcgttcgatcacctgatccgcacgagcgtcgaagacgcggag
gatgcacaggcggcggcgatggccgaggtctga

DBGET integrated database retrieval system