KEGG   Paraburkholderia phymatum: Bphy_3822Help
Entry
Bphy_3822         CDS       T00704                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00440  Phosphonate and phosphinate metabolism
bph01100  Metabolic pathways
bph01120  Microbial metabolism in diverse environments
bph01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bph00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Bphy_3822
Enzymes [BR:bph01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Bphy_3822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: ACC72953
UniProt: B2JNA5
LinkDB All DBs
Position
2:complement(786060..787766)
Genome map
AA seq 568 aa AA seqDB search
MNAREPSFTTLSRSARLRQMLTSNELEFLMEAHNGISARIVREAGFKGIWGSGLAISAQY
GVRDNNEASWTQVVDTLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIE
DKVFPKTNSFIKGEAQPLADIDEFCGKIKAGKDSQTDEDFSIVARVEALIAGWGMEEALK
RAEAYRQAGADAILIHSKLSRPDEILEFAREWAGRGPLVIVPTKYYSTPTEVFRKAGIST
VIWANHQIRAATSAMQAVVKEIYESQTLVNVEDRIATVNEIFRLQNADEYSEAEERYLSS
SRAAGSAVVLAASRGAGLEAVTTDRPKVMLPIAGKPLLRWLVDAFKKQGVNDITVVGGYR
ADAIDTAGIKLVVNERHEQTGELASLACAIDNLQNDTLISYGDLLFRSYIVRDLVESEAP
FSVVVDSTTIDETGAANQSVRDFAWCSAGDDRGLFGNKVLLRRVSNNEADLHGAAPNGRW
IGLLNVRGGGRERLQAVMSTLRARPDFDSLDMPALLNALLEAGEEIEVQYVHGHWRGVND
LEDFRRAGDFAHEATPLAKGDAAGGAAQ
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgaaccctctttcaccactctgtcgcgcagcgcacgcctgcgccagatg
ctcaccagcaatgaactcgaattcctgatggaagctcataacggcatctccgcgcgtatc
gtgcgcgaagccggcttcaagggcatctggggctcgggcctcgcgatctccgcgcagtac
ggcgtgcgcgacaacaacgaagctagctggacccaggtcgtcgataccctcgaattcatg
gccgacgcgagcgatctgcccatcctgcttgacggcgataccggctacggcaacttcaac
aacgtgcgccgcctcgtgcgcaagctggaacagcgcggcatcgctggcgtctgtatcgaa
gacaaggtgttcccgaagacgaacagcttcatcaagggcgaagcgcagccgctcgccgat
atcgacgagttctgcggcaagatcaaggccggcaaggattcgcagacggatgaggacttc
tcgatcgtcgcacgcgtcgaagcactgatcgcaggctggggcatggaagaagcgctcaag
cgcgcagaagcgtatcgccaggcgggcgccgacgcgatcctgattcacagcaagctgtcg
cgtcccgacgagattctcgagttcgcccgcgaatgggcaggccgcggtccgctcgtgatc
gtgccgaccaagtactacagcacgccgacagaagtgttccgcaaggcaggcatcagcacg
gtgatctgggcaaaccatcagattcgcgcagcgacctcggcgatgcaggccgtcgtcaag
gaaatctacgagagccagacgctcgtcaacgtcgaagaccgcatcgcgaccgtcaacgaa
atcttccgtctgcagaacgccgacgaatactcggaggcggaagagcgttatctttcgtcg
tcgcgcgcggcgggctcggctgtcgtgctcgccgcgagccgcggcgcagggctcgaagcc
gtcacgacggatcgcccgaaggtcatgctgcccatcgcgggcaagccgctgctgcgctgg
ctcgtcgatgcgttcaagaagcagggcgtcaacgacatcacggtggtcggcggttatcgc
gccgacgcgatcgataccgccggcatcaagctcgtcgtcaacgagcgccacgagcagacg
ggtgaactggcgtcgctcgcatgcgcgatcgacaacctgcagaacgacaccttgatctcg
tacggcgacctgttgttccgcagctatatcgtgcgcgatctggtggagagcgaggcgccc
ttcagcgtggtagtcgattcgacgacgatcgatgaaacgggtgcggcgaaccagagcgtg
cgcgacttcgcgtggtgctcggccggcgacgatcgcggtctgttcggcaacaaggtgctg
ctgcgccgcgtgtcgaacaacgaagccgacctgcacggcgcagcgccgaacggccgctgg
atcggcctcctgaacgtgcgcggcggaggccgtgagcgtctgcaagcggtgatgagcacg
ctgcgtgcacgtcccgatttcgattccctcgatatgcccgcgctgttgaacgcattgctc
gaagccggtgaagaaatcgaagtgcaatacgtgcacggccactggcgcggcgtgaacgac
ctcgaagacttccgccgcgcaggcgacttcgcgcacgaagccacgccgctcgcgaagggt
gatgcagcgggaggcgccgctcaatga

DBGET integrated database retrieval system