KEGG   Paraburkholderia phymatum: Bphy_4314Help
Entry
Bphy_4314         CDS       T00704                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bph00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Bphy_4314
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bph02000]
    Bphy_4314
Enzymes [BR:bph01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Bphy_4314
Transporters [BR:bph02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bphy_4314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_4 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ACC73430
UniProt: B2JQ89
LinkDB All DBs
Position
2:1325999..1326664
Genome map
AA seq 221 aa AA seqDB search
MANTSAMSTLTISSRNYSSWSLRGWLLTKFSGLPFEEIVMPVDDPAARAELLLLSPSILV
PCLVHDGVKVWDTLAIAEYLNEVCPQAALLPKDRKARAHCRAICGEMHSGFSSLRSALPM
NLKAHFPGFKVWARAQSDIERIVTIWRECLEQYGGPYLFGERSAADAMYAPVVTRFVTYD
VQLDPDIVAYGERILALPEMQQWIAEAQKEVDEIDELDVEF
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacacgtcggctatgagcacgttgaccatcagcagccgcaactattcttcgtgg
tcgctacgcggttggctgctcacgaagttcagcggcttgccgttcgaagaaatcgtgatg
cccgtcgacgatcccgccgcgcgcgccgaactgctgttgctgtcgccgtcgatactcgtg
ccgtgtctcgtgcacgacggcgtcaaggtatgggacacgctcgcaatcgccgaatatctg
aacgaagtgtgtccgcaagccgctctgctgccgaaggaccgcaaggcgcgcgcgcactgc
cgcgcgatctgcggcgaaatgcattcgggcttcagctcgttgcgctcggctctgccgatg
aacctgaaagctcattttccgggcttcaaggtgtgggcgcgcgcgcagtccgatatcgaa
cgtatcgtgacgatctggcgcgagtgtctggagcaatacggcgggccgtatctgttcggc
gagcgaagcgctgcggacgcgatgtacgcgcccgtcgtcacgcgcttcgtgacctatgac
gtgcaactcgatcccgatatcgttgcgtatggggagcgcattctcgcgctgcccgagatg
cagcagtggatcgccgaagcacagaaggaagtggatgaaatcgacgaactcgacgtcgag
ttctag

DBGET integrated database retrieval system