KEGG   Paraburkholderia phymatum: Bphy_4363Help
Entry
Bphy_4363         CDS       T00704                                 

Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00020  Citrate cycle (TCA cycle)
bph00190  Oxidative phosphorylation
bph00650  Butanoate metabolism
bph01100  Metabolic pathways
bph01110  Biosynthesis of secondary metabolites
bph01120  Microbial metabolism in diverse environments
bph01130  Biosynthesis of antibiotics
bph01200  Carbon metabolism
Module
bph_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bph_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bph_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bphy_4363
   00650 Butanoate metabolism
    Bphy_4363
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Bphy_4363
Enzymes [BR:bph01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Bphy_4363
    1.3.5.4  fumarate reductase (quinol)
     Bphy_4363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO FAD_binding_3 Thi4 Pyr_redox_2 GIDA HI0933_like FAD_oxidored Lycopene_cycl Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ACC73478
UniProt: B2JQD7
LinkDB All DBs
Position
2:1389133..1390908
Genome map
AA seq 591 aa AA seqDB search
MVAIKNSLPRRKFDVVIVGAGGSGMRASLQLARAGLSVCVLSKVFPTRSHTVAAQGGIGA
SLGNMSEDNWHYHFYDTIKGSDWLGDQDAIEFMCREAPNAVYELEHFGMPFDRNADGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVAAKTTFFVEWMALDLIRDADG
DVLGVTALEMETGDVYILEGKTTLFATGGAGRIFAASTNAFINTGDGLGMAARAGIPLED
MEFWQFHPTGVAGAGVLITEGVRGEGGILRNANGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGVGPNKDHVLLDLSHIGAETIMKRLPSIREIALKFANVDCIKEPIPVVPTIHYQ
MGGIPTNIHGQVVGTAKGHEDPINGFYAVGECSCVSVHGANRLGTNSLLDLVVFGRAAGN
HIVRHVKEIKEHKPLPADAADFALSRLAKLDSSSSGEYAQVVANDIRSTMQKHAGVFRTS
ALLAEGVERIREVAGRVGNIHLKDKSKVFNTARVEALEVENLIEVARATMVSAEARKESR
GAHAQNDFEHRDDENWLRHTLWYSEGDRLDYKPVHMNPLTVESVPPKARTF
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggttgcaatcaagaattccctgccgcgccgcaaatttgacgtggtcatcgtcggcgcg
ggcggctcgggcatgcgcgcgtcgctgcagctcgcgcgcgcgggcctctccgtgtgcgtg
ctctcgaaggtgttcccgacgcgttcgcacaccgtcgcggcgcagggcggcatcggcgcg
tcgctcggcaacatgagcgaagacaactggcactaccacttctacgacacgatcaagggc
tccgactggctcggcgaccaggacgcgatcgagttcatgtgccgcgaagcgccgaacgcg
gtctacgaactggaacacttcggcatgccgttcgaccgcaacgcggacggcacgatctac
cagcgcccgttcggcggccacaccgcgaactacggcgagaagcccgtgcagcgcgcgtgc
gctgccgctgaccggaccggccacgcgctgctgcacacgctgtaccagcagaacgtcgcg
gcgaagacgacgttcttcgtcgaatggatggcgctggacctgatccgcgacgccgatggc
gacgtgctcggggtgaccgcgctggaaatggaaacgggcgacgtctatatcctcgaaggc
aagaccacgctgttcgccacgggcggcgcgggccgcatcttcgcggcatcgacgaatgcg
ttcatcaacacgggcgacggcctgggcatggccgcacgcgcgggcatcccgctcgaggac
atggaattctggcagttccacccgacgggcgtggcgggcgcgggcgtgctgatcactgaa
ggcgtgcgcggcgaaggcggcattctgcgcaacgcgaacggcgagcgcttcatggagcgc
tacgcgccgacgctgaaggacctggcgccgcgcgatttcgtctcgcgctcgatggaccag
gagatcaaggaaggccgcggcgtgggcccgaacaaggaccacgtgctgctggacctgtcg
cacatcggcgcggagacgatcatgaagcgtctgccgtcgatccgcgagatcgcgctgaag
ttcgcaaacgtcgactgcatcaaggagccgatcccggttgttccgaccatccactaccag
atgggcggcattccgacgaacatccacggtcaggtcgtgggcaccgcgaagggccacgaa
gacccgatcaacggcttctacgccgtgggcgaatgctcgtgcgtgtcggtgcacggggca
aaccggctgggcacgaactcgctgctcgacctggtggtattcggccgcgcggcgggcaac
cacatcgtcaggcacgtgaaggaaatcaaggaacacaagccgctgccggccgatgcagcc
gatttcgcgctctcgcgtctggcgaagctcgacagctcgagctcgggcgagtacgcgcag
gttgtcgcgaacgacatccgctcgacgatgcaaaagcatgcgggcgtgttccgcacgtcg
gcgctgctggccgaaggcgtcgaacgcattcgcgaagtggccggccgtgtgggcaacatc
cacctgaaggacaagtcgaaggtattcaacacggcgcgcgtggaagcgctcgaagtggag
aacctgatcgaagtggcgcgcgcgacgatggtgtcggccgaggcgcgcaaggaaagccgc
ggcgcacacgcgcagaacgacttcgaacatcgcgacgacgagaactggctgcgccatacg
ctgtggtacagcgaaggcgaccgcctcgactacaagccggtgcacatgaacccgctgacg
gtcgaatcggtgccgcccaaagcgcgtaccttctaa

DBGET integrated database retrieval system