KEGG   Paraburkholderia phymatum: Bphy_4364Help
Entry
Bphy_4364         CDS       T00704                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00020  Citrate cycle (TCA cycle)
bph00190  Oxidative phosphorylation
bph00650  Butanoate metabolism
bph01100  Metabolic pathways
bph01110  Biosynthesis of secondary metabolites
bph01120  Microbial metabolism in diverse environments
bph01130  Biosynthesis of antibiotics
bph01200  Carbon metabolism
Module
bph_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bph_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bph_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bphy_4364
   00650 Butanoate metabolism
    Bphy_4364
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Bphy_4364
Enzymes [BR:bph01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Bphy_4364
    1.3.5.4  fumarate reductase (quinol)
     Bphy_4364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4_4 Fer4 Fer2
Motif
Other DBs
NCBI-ProteinID: ACC73479
UniProt: B2JQD8
LinkDB All DBs
Position
2:1390940..1391644
Genome map
AA seq 234 aa AA seqDB search
MAKRTFEIYRYDPDKDAAPRMQTYEIEIDSHERMLLDALVKLKALDETLSFRRSCREGVC
GSDAMNINGKNGLACLTNLNELPQKIVLRPLPGLPVVRDLICDFTQFFNQYHSIRPYLIN
DTPPPEKERLQSPEERDELDGLYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIAD
SRDEATGERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKELMVRRTV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcgtacatttgaaatctaccgctacgacccggacaaggacgccgcaccgcgc
atgcagacgtacgagatcgagatcgactcgcacgagcgcatgctgctcgacgcgctggtg
aagctcaaggcactggacgagacgctgtcgttccgtcgctcgtgccgtgaaggcgtgtgc
ggctcggacgcgatgaacatcaacggcaagaacggtcttgcgtgtctgacgaacctgaac
gagctgccgcagaagatcgtgctgcgtccgctgccggggctgcccgtggtgcgcgacctg
atctgcgacttcacgcagttcttcaaccagtaccactcgatcaggccgtacctgatcaac
gacacgccgccgccggagaaggagcgtctgcagtcgccggaagagcgcgacgagctcgac
gggctgtacgagtgcattctgtgcgcgagctgctcgacgtcgtgcccgagcttctggtgg
aatccggacaagttcgtgggcccggcggggctgctgcaggcctaccgtttcatcgcggac
agccgtgacgaagcgacaggcgagcggctggacaatctggaagatccgtaccgtctgttc
cgttgccatacgatcatgaactgcgtcgacgtgtgcccgaaggggctcaatccgacgaag
gcgatcggcaagatcaaggaattgatggtgcgccggacggtctga

DBGET integrated database retrieval system