KEGG   Paraburkholderia phymatum: Bphy_4618Help
Entry
Bphy_4618         CDS       T00704                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00250  Alanine, aspartate and glutamate metabolism
bph00410  beta-Alanine metabolism
bph00640  Propanoate metabolism
bph00650  Butanoate metabolism
bph01100  Metabolic pathways
bph01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Bphy_4618
   00650 Butanoate metabolism
    Bphy_4618
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bphy_4618
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bphy_4618
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bph01007]
    Bphy_4618
Enzymes [BR:bph01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Bphy_4618
Amino acid related enzymes [BR:bph01007]
 Aminotransferase (transaminase)
  Class III
   Bphy_4618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACC73728
UniProt: B2JR37
LinkDB All DBs
Position
2:complement(1680470..1681753)
Genome map
AA seq 427 aa AA seqDB search
MKNAELKSRKDAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVCNTGHRHPK
IVEAVRAQLDHFTHTAYQIVPYASYVELAEKINERAPGDYPKKTAFFTTGAEAVENAIKI
ARAFTGRPGVIAFTGGFHGRTMMGMALTGKVAPYKLNFGPFPADVFHAPFPNPLHGVTTA
DSLKAIEFLFKADIDPKRVAAIIFEPVQGEGGFYPAPAEFVRALRKLCNEHGILLIADEV
QTGFARTGKLFAMNHYDVVPDLMTMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVASAHAVLDIIDEERLCERAVVLGDRLKAKLTALQSEVPLIADVRGPGGMVAVEFCK
PGTSEADADFTKRVQTRALERGLLLLVCGVYSNVVRFLFPLTIQDSVFDEAVSILEEVLK
ETVGVAA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgctgaactgaagagccgcaaggacgccgccacgccgcgcggcgtaggcgtg
atgtgcgatttctacgctgcgcgtgcggagaatgcggagctgtgggacgtcgagggccgc
cgcttcatcgatttcgcggccggcattgccgtttgcaacacggggcatcgtcatccgaag
atcgtcgaggccgtgcgcgcccaactcgaccacttcacgcacaccgcttatcagatcgtg
ccgtatgcgtcgtatgtcgagctggcggaaaagatcaacgagcgcgcgccgggcgactat
ccgaagaagactgcattctttacgacgggcgccgaagccgtcgaaaacgcgatcaagatc
gcacgcgccttcacgggccgtccgggcgtgatcgcgttcacgggcggctttcacggccgc
acgatgatgggcatggcgctgacgggcaaggtcgcgccgtacaagctgaacttcggcccg
ttcccggccgatgtattccacgcaccgttcccgaatccgctgcatggcgtgacgacggcg
gactcgttgaaggcgatcgaatttctgttcaaggcggacatcgatccgaagcgcgtcgcg
gcgatcattttcgagccggtgcaaggcgaaggcggtttctatccggcgcctgccgagttc
gtgcgggcgctgcgcaagctgtgcaacgagcacggcattctgctgatcgcggacgaagtg
cagacgggttttgcacgcacgggcaagctgttcgcgatgaatcactatgacgtggttccc
gacctgatgacgatggcgaagagcctcgcgggcggcatgccgctgtcgggtgtggtcggg
cgtgcggatgtgatggatgcggctgcgccgggcggactgggcggcacgtacgcgggcaat
ccgctcgcggttgcttcggcgcatgcggtgctcgacatcatcgacgaagagcggctctgc
gagcgggctgtggtgttgggggatcgcctgaaggcgaagttgacggcgcttcagtcggaa
gtgccgctgatcgccgatgtgcgcgggccgggcggcatggtggccgtcgagttctgcaag
ccgggtacgtcggaggcggatgccgatttcacgaagcgcgtgcagactcgcgcgctcgag
cgcgggttgctgttgctggtgtgtggtgtttattcgaacgttgttcggtttttgttcccg
ttgactattcaggattcggtcttcgatgaagctgtttccattctcgaagaggtgctgaaa
gagactgttggcgtagcggcctga

DBGET integrated database retrieval system