KEGG   Paraburkholderia phymatum: Bphy_5237Help
Entry
Bphy_5237         CDS       T00704                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00500  Starch and sucrose metabolism
bph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bphy_5237
Enzymes [BR:bph01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Bphy_5237
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Bphy_5237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase RcnB
Motif
Other DBs
NCBI-ProteinID: ACC74320
UniProt: B2JMS7
LinkDB All DBs
Position
2:complement(2360930..2362594)
Genome map
AA seq 554 aa AA seqDB search
MLNDLWYKNAIIYCLSVGTFMDANGDGIGDFAGLMRRLDYLQGLGITAIWLMPIQPSPGR
DNGYDVSDYYNVDPKYGTLGDFAEFTHACAERGLRVIIDLVVNHTSDQHPWFKEARSDPD
SKYRDWYVWADKKPPDATHGVAFPGVQKSTWSFDKRARRWYFHRFYDFQPDLNTSNPHVQ
AELLKIMGFWIQLGVSGFRMDAVPFVIATKGPKVREPVEQYEMLRSFREFLQWREGDAII
LAEANVLPDTDLEYFGEEGERLPMMFNFQLNQNTFYTLATGDTKPLKHALLATKPRPPSA
QWGVFLRNHDELDLGRLTPEQRAAVFAAFGPEPGMQLYQRGIRRRLAPMLAGDRRHLELA
YSLMLSLPGTPVFRYGDEIGMGDDLRRPERACARTPMQWSTEPQGGFTKHTRPPVSVISG
GPYGFERVNVATQRRDPNSLLNWMERMIRMRKEVPEISWGDFEVLRTSRSDVLALCYHWR
NNSVLFLHNFAAKACTVKFRSGCNEPVGCPLINLLSDDHSQPGDDGRHAVVLEPYGYRWY
RVGGLDYLLTRSEI
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgctcaacgacctctggtacaagaacgcaatcatctactgcctttccgtcggcacgttc
atggacgccaatggcgacggcatcggcgacttcgctgggctgatgcgccgcctcgattat
ctgcagggtctcggcatcaccgcgatctggctgatgcccattcagccatcgcccgggcgc
gacaacggttacgacgtctccgactactacaacgtcgatccgaagtacggcacgctcggt
gacttcgccgaattcactcacgcctgtgccgagcgtggcctgcgcgtgatcatcgacctg
gtagtcaatcacacttccgaccagcacccgtggttcaaggaagcacgcagcgatcctgat
tcgaaatatcgcgactggtatgtgtgggcggacaagaagccgcccgacgcaacacacggc
gtcgcattccctggcgttcagaagtcgacatggagtttcgacaaacgtgcaaggcgctgg
tatttccatcgtttctacgattttcaaccagacctgaatacctccaatcctcacgtgcag
gcggaactgctgaagatcatgggcttctggatccagcttggcgtttccggattccgcatg
gatgcagtgcccttcgtcatcgcaacgaaggggccgaaagtgcgcgaacccgtcgagcaa
tatgaaatgttgcggagctttcgcgagttcctgcaatggcgcgaaggtgatgcgatcatt
ctggccgaagctaacgtcctgccggataccgacctcgaatatttcggtgaagagggcgag
cgcttgcccatgatgttcaacttccagctcaaccagaacaccttctatacgcttgcgacg
ggcgatacgaagccgttgaagcacgccctcctcgcaacgaagccgcggccgccaagcgcg
caatggggcgtgttcctgcgcaatcacgacgagctcgatctcggtcgcctcacgcctgag
caacgcgcagccgtattcgctgcattcggtcccgagccgggcatgcagctttatcagcgc
ggcatccggcgccggctcgcgccgatgctggcaggcgacaggcgccaccttgaactcgcc
tacagcctgatgctcagtttgccgggcacgcccgtgttccgttacggcgatgaaatcggc
atgggcgacgacctgcgccggcccgagcgcgcatgtgcgcgtactcccatgcaatggtcg
accgagccgcagggaggcttcaccaagcacacccggccgcccgtatcggtcatatccggc
ggcccttatggctttgagcgcgtcaacgttgcgacccagcggcgcgaccccaactcgctt
cttaactggatggagcggatgatccgcatgcgcaaggaagtgccggagatcagctggggg
gatttcgaagtgctgcgcacatcgcgaagcgatgtgctggcgctgtgttatcactggcgc
aacaactcggttctgtttctacataacttcgccgccaaggcgtgcacagtgaagtttcgc
tccggctgcaacgagccggtgggctgcccgctgatcaatctgctctccgacgaccacagc
cagcctggcgacgacggccgacatgcagtggtgctggagccttacggttaccgctggtac
agggtcggcggactggattatctgctgacgcgttccgaaatataa

DBGET integrated database retrieval system