KEGG   Paraburkholderia phymatum: Bphy_5613Help
Entry
Bphy_5613         CDS       T00704                                 

Definition
(GenBank) Cystathionine gamma-synthase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00270  Cysteine and methionine metabolism
bph00450  Selenocompound metabolism
bph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bph00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Bphy_5613
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Bphy_5613
Enzymes [BR:bph01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     Bphy_5613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACC74687
UniProt: B2JUG5
LinkDB All DBs
Position
pBPHY01:complement(82509..83792)
Genome map
AA seq 427 aa AA seqDB search
MSYGSYHKRKIAGRDLHPETQMMSYGYDPFLSEGSVKAPVFLTSTFAFRTAEDGAEFFDR
VSGRKPLPEGESAGLVYSRFNHPNLEIVEDRLALLDDSEAAVVTSSGMAAIAAILLTFLR
PGDCVVQSAPLYGGTETLVSKFLPEWGIASEVIEDGLSIAAIRNALEAAAQRGKVRMCYV
ETPANPTNALFDLEGLRQEIDAFETRHGYRPLSVCDNTLLGPLFQKPVNHGIDLSVYSLT
KYIGGHSDLVAGGVTGNQGLITRVRAIRSMFGSQLDPHSCWMITRSMETLVLRMQHAARS
GATVARWLASNPFKPVKVLHPELTNDPAYRAVYRRQCSGPGSTFAFVLDGGRAQAFRFID
RLTLFKSAVSLGGTESLICHPASTTHSGVPAEVRLAAGVSEGLIRASVGLEHPDDLIADL
SNALEHC
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacggcagctatcacaagcgcaaaatcgcaggccgcgacctgcaccccgaaacc
cagatgatgtcctatggctacgatcctttcctgtccgaaggatcggtcaaggctcccgtc
ttcttgacatcgacgttcgcatttcgcaccgccgaagacggcgctgagttcttcgacagg
gtatcgggccgcaagccgctgcccgaaggggaaagcgcgggcctggtgtatagccgcttc
aatcatccgaatctggagatagtcgaagatcggctcgcgctgctcgacgattcggaagcg
gccgtcgtgacatcgagtggaatggccgcaatagcggcaattctgctgaccttcttgcgg
cccggcgactgtgtggtgcaatcggcgccgctgtacggaggaaccgaaacgctggtttcg
aagttcttgcccgaatggggcatcgcgtccgaggtaatcgaggacggtctgtcgatcgcc
gcaattcgcaacgcactcgaagcggccgcccaacgaggcaaggtgcgcatgtgctatgtc
gagacgccggccaaccccactaacgcgctattcgatctcgaaggcctgcggcaggagatc
gacgcattcgaaacacgtcatggatacaggccgctttccgtgtgcgacaacacgttgctc
ggtccgttgtttcagaagcccgtgaatcatggcatcgacctgagcgtgtattcgctcacg
aagtacatcggcggacacagcgatctggtcgcgggtggcgtcacgggcaatcaagggttg
atcaccagggtgcgagccattcgaagcatgttcggctcgcaactggatccgcattcctgc
tggatgatcacacgctcgatggaaacactcgtgctacgcatgcaacacgccgcacgcagc
ggcgccaccgtcgcgcgctggctcgcgagcaatccgttcaagcccgtgaaggtactgcac
ccggaactgaccaacgaccccgcgtaccgggccgtgtatcggcggcaatgcagcggtccc
ggttcgacgttcgctttcgtgctggacggcggccgcgcacaggcattccggttcatcgat
cggttgacgcttttcaagtcggccgtgagtctgggcgggacggaatcgctaatctgccat
cccgcttcgactacccattcgggtgtgcccgctgaagtccggctagccgcaggcgtttca
gagggcttgatacgcgcgtcggttggcctggaacatcccgacgatctcattgccgacctg
tcgaatgcgctcgaacactgctga

DBGET integrated database retrieval system