KEGG   Paraburkholderia phymatum: Bphy_5822Help
Entry
Bphy_5822         CDS       T00704                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00061  Fatty acid biosynthesis
bph00780  Biotin metabolism
bph01100  Metabolic pathways
bph01130  Biosynthesis of antibiotics
bph01212  Fatty acid metabolism
Module
bph_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bph00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Bphy_5822
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Bphy_5822
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Bphy_5822
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bph01004]
    Bphy_5822
Enzymes [BR:bph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     Bphy_5822
Lipid biosynthesis proteins [BR:bph01004]
 Fatty acid synthase
  Component type
   Bphy_5822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1776 THF_DHG_CYH_C XFP_C
Motif
Other DBs
NCBI-ProteinID: ACC74888
UniProt: B2JVB1
LinkDB All DBs
Position
pBPHY01:328864..329610
Genome map
AA seq 248 aa AA seqDB search
MSKLAGKVAVVTGASKGIGAGIAKALAAEGASVVVNYSSSKAAADAVVADITAAKGKAIA
VGGDVSKAADAQGIIHAAVETYGRIDILVNNSGVYEFAPIEEFTEDQFHRQFNINVLGLL
LTTQAAVKHLGEGASIINISSVVTSITPPTTAIYSGTKGAVDAITGVLSRELGPKKIRVN
AINPGIVITEGTHEAGIAGSDFETMAVSQTPLGRVGQPSDIASIAVFLASDDSGWLTGET
IVASGGMR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcttgcaggtaaggtcgctgtcgtcacgggcgcttcgaagggcatcggtgcg
ggcatcgcgaaggcgctcgcggcggaaggcgcttccgtggtggtcaactactcgagcagc
aaagctgctgccgatgcggtcgtggctgacattacggcggcaaagggcaaggcgattgcg
gtcggcggcgatgtgtcgaaggctgcggatgcgcagggcatcatccatgcagccgtcgaa
acgtatggccgcatcgacatcctggtgaacaattcaggcgtctacgaattcgcgccgatc
gaagaattcacggaagatcaattccaccgccagttcaatatcaatgtgctaggtctgctg
ctgacgacgcaagccgccgtcaagcaccttggcgaaggcgcgagcatcatcaacatcagt
tcggtggtgacgagcatcacgccgccgacgacggccatctacagcggcacgaaaggcgct
gtcgacgcgatcacgggcgtgctgtcgcgcgaactgggaccgaagaagattcgcgtgaac
gcaatcaatccgggcatcgtgattacggaaggcacgcacgaagcgggcatcgccggctcc
gacttcgaaacgatggccgtgagccagacgcctcttggccgtgtgggccagccgagcgac
atcgcgtcgattgcggtgttcctcgcctccgacgactcgggctggctgacgggcgaaacc
atcgtcgcaagcggcgggatgcgctga

DBGET integrated database retrieval system