KEGG   Paraburkholderia phymatum: Bphy_6497Help
Entry
Bphy_6497         CDS       T00704                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00630  Glyoxylate and dicarboxylate metabolism
bph01100  Metabolic pathways
bph01120  Microbial metabolism in diverse environments
bph01200  Carbon metabolism
Module
bph_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Bphy_6497
Enzymes [BR:bph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Bphy_6497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ACC75527
UniProt: B2JX50
LinkDB All DBs
Position
pBPHY01:complement(1077538..1079043)
Genome map
AA seq 501 aa AA seqDB search
MNDFSKEAVKPADSATAAAKAEKRSRYAAGVMKYREMGYWQPDYTPKDTDVIALFRITPQ
PGVEPEEAAAAVAGESSTATWTVVWTDRLTACDMYRAKAFRVEPVPNPAEGEPQYFAFIA
YELDLFEEGSVANLTASIIGNVFGFKPLKALRLEDMRIPVAYLKTFQGPPTGIVVERERL
DKYGRPLLGATVKPKLGLSGKNYGRVVYEGLKGGLDFLKDDENINSQPFMHWRDRYLFAM
EAVHRAQAETGEVKGHYLNVTAGTMEDMYERAEFAKELGSCIVMIDLVIGWTAITSMGRW
ARKNDMILHLHRAGHGTYTRQRNHGISFRVIAKWLRMAGVDHAHAGTAVGKLDGDPLSVQ
GYYNVLRESHNSVDLTRGIFFDQHWAGLRKVMPVASGGIHAGQMHQLLDLFGDDAILQFG
GGTIGHPSGIQAGATANRVALETMVKARNEGRDIANEGSDLLEAAARHCTPLKQALDTWG
DVTFNYTPTDSPDFAVTPSVA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatttcagcaaggaagccgtgaagccggccgatagcgccaccgcagccgccaag
gcggaaaagcgctcacgctacgcggcaggcgtgatgaaatatcgcgagatgggctactgg
cagccggactacacgccgaaagacaccgacgtcatcgcgctcttccgcatcacgccgcag
ccaggggtcgaaccggaagaggccgcggccgccgtcgcaggcgaatcgtcgacggcaacg
tggaccgtggtctggaccgatcgtcttaccgcgtgcgacatgtatcgcgcgaaagcgttt
cgcgtcgagcccgtaccgaatccggccgaaggcgagccgcagtacttcgcgttcatcgcc
tacgaactcgacctcttcgaagaagggtcggtggcgaatctcacggcttccatcatcggc
aatgtgttcggcttcaagcctctcaaagcgctgcggctcgaagacatgcgcattcccgtc
gcgtatctgaagacgttccagggcccgccgacaggcatcgtcgtcgaacgcgaacggctc
gacaagtatggccgtccgctgctcggtgcgaccgtcaagccgaagctcgggctgtcggga
aagaactatgggcgcgtcgtgtacgaaggcctcaaaggcggcctcgactttttgaaggac
gatgaaaacatcaattcgcagcccttcatgcactggcgcgaccgctatctgttcgcgatg
gaagcggtgcatcgcgcgcaagccgaaacaggtgaagtgaagggccattacctgaacgtg
acggcgggcacgatggaggacatgtacgagcgcgccgaattcgcgaaagaactgggctcc
tgcatcgtgatgatcgatctcgtgatcggctggaccgcgatcacgtcgatgggacgctgg
gcgcgcaagaacgacatgatcctgcatctgcatcgcgcgggtcacggcacgtacacgcgg
cagcgcaatcacggcatctcgtttcgggtgatcgcaaaatggctgcgcatggcgggcgtc
gatcatgcccatgcgggtacggccgttggcaagctcgacggcgacccgctctccgtgcag
ggctattacaacgtgctgcgcgaatcgcacaactccgtcgatctgacgcgcggcatcttc
ttcgatcagcattgggcaggcttgcgcaaggtgatgcccgtcgcgtcgggcggcattcac
gcggggcagatgcatcagctgctcgacctgttcggcgacgacgcgatcctgcagttcggc
ggcggcacgatcgggcatccgtcgggcatccaggcgggcgcgacggcgaaccgcgtcgca
ctcgagacgatggtcaaggcgcgcaacgaaggccgcgacatcgcgaacgaaggctccgat
ctgctcgaagcggcggcgcgtcattgcacgccgctcaagcaggcgctcgatacatggggc
gacgtcacgttcaactacacgccgaccgattcgcccgatttcgccgtcacgccgagcgtg
gcgtga

DBGET integrated database retrieval system