KEGG   Blattabacterium sp. BPLAN (Periplaneta americana): BPLAN_182Help
Entry
BPLAN_182         CDS       T00996                                 

Gene name
glpA
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bpi  Blattabacterium sp. BPLAN (Periplaneta americana)
Pathway
bpi00564  Glycerophospholipid metabolism
bpi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BPLAN_182 (glpA)
Enzymes [BR:bpi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BPLAN_182 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Pyr_redox_2 HI0933_like NAD_binding_8 Pyr_redox_3 Lycopene_cycl Thi4 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ACX83811
UniProt: D0J8Z0
LinkDB All DBs
Position
complement(197714..199315)
Genome map
AA seq 533 aa AA seqDB search
MMKGFFNRERFLGILENINIWDVLVIGGGATGLGIALDSASRGYKTLLLEQSDFSKGTSS
RSTKLVHGGIRYLAQGNIKLVYEALQERGHLLKNAPHLVKKQRFVIPIFSWRMGFFYWAG
LKFYEWLAGSLSFGKSQFLSRNEMLKIFPEIRPNSLKGGILYYDGQFDDARLAINLAKTC
VQQGGVVLNYFQVKNLIKEIGKISGVIAYDLETKKKYSIYSKTVINATGVFSDSISKMDE
STWPILIKPSQGTHIVLKKSFFSSSNAIVIPKTTDGRILFSVPWYDHVLIGTTDTFLDKS
DLEPKPLEEEIDFILHTFKQYFVYTPKKKDILSAFSGLRPLFVPRHFSFSASTHTKDISR
SHKLMISPSGLLTIIGGKWTTYRKMAEETVNKAVEIGKLNKVPPITKNLKIYGAIPSCKN
YNFHWKKYGEDESHIQKLIEENPLWGEPLISKCPSYYCTEAEVIWMVRHEMARTVEDVLA
RRFRLLFLNAKKAIDIAPRVAALMAQELSLDKTWEKSQVAAFKELAMQYYYPV
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaggtttttttaatagagaaaggtttttaggaattttagaaaatataaatatt
tgggatgttttggttattggagggggggctacaggattgggaatagctttggattcagct
tctagaggttataaaactcttcttttagaacaatctgacttttctaaaggaacttctagt
cgtagtactaaattagttcacggaggaatacgatatttggctcaaggaaatataaaatta
gtctatgaagctttacaggaaagaggccatttgttgaaaaatgctcctcatttggtaaaa
aaacaacgatttgttattcctatttttagttggagaatgggatttttctattgggcgggt
ttgaaattttatgaatggttagctggttctcttagttttggaaaatctcaatttttatcc
agaaatgaaatgctgaaaatatttcctgaaattcgaccaaatagtttaaaaggaggtatt
ttatattatgatggacagtttgatgatgctcgtttggctattaatttagccaaaacttgt
gttcagcaaggaggagtagtgttgaattattttcaagtaaaaaatcttattaaagaaata
ggaaaaatatctggagtgatagcttatgatcttgaaactaaaaaaaaatattctatttat
tcaaaaacagttattaatgccacaggggttttttcagattctatttctaaaatggatgaa
tccacatggcctattttaataaaacctagtcaagggacgcatattgttttaaaaaaatcc
ttttttagcagttcaaatgctatagtcattccaaaaactacggatggtagaattcttttt
agtgttccatggtatgatcatgttttgataggaactacagatacttttttagataagagt
gatcttgaacctaaacctttagaagaagaaatagattttattctacatacttttaaacaa
tactttgtatatacaccgaaaaaaaaggatattctaagtgctttttcaggtttacgtcct
ctttttgttcctcgtcatttttctttttctgcttccactcatactaaagacatatctaga
tctcataaacttatgattagtccttctggactattaactatcataggtggaaaatggaca
acatatagaaaaatggcagaagaaactgtcaataaagctgttgagataggaaaattgaat
aaagttcctcctataacaaaaaatctgaaaatttatggagccatcccttcatgcaagaat
tataattttcattggaaaaaatatggagaggatgaatctcacattcaaaaattaattgag
gaaaatcctctatggggagagcccttaatatctaaatgtccttcttattattgtactgaa
gcagaagttatttggatggtccgtcatgaaatggctagaacggttgaagatgttttagca
agaaggtttcgtttattatttttaaatgctaaaaaagcgatagatatagcaccaagagta
gcagcattaatggctcaagaactttctctagataaaacatgggaaaaatcacaggtagct
gctttcaaagagttagctatgcaatattattatccagtttaa

DBGET integrated database retrieval system