KEGG   Brachyspira pilosicoli P43/6/78: BPP43_02025Help
Entry
BPP43_02025       CDS       T02387                                 

Definition
(GenBank) alpha glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
bpip00500  Starch and sucrose metabolism
bpip01100  Metabolic pathways
bpip01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BPP43_02025
Enzymes [BR:bpip01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     BPP43_02025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: AGA65735
UniProt: A0A3B6VPR0
LinkDB All DBs
Position
424674..427238
Genome map
AA seq 854 aa AA seqDB search
MKVSKYMVSPSVPKELEPLMEITKNFWWVWNQKAINLLRNIDIDNWDKKDHNPIRLLGES
SQECFDTMLHDDAAMMNLAEVYDEFKTYMNQETWYDSLDDSQKTKNEKIAYFSFEYGLHE
SLPNYSGGLGILSGDHLKSASDLGLPFVAVGLLYRKGYFRQYLNADGWQQEYDIENDFFN
LALEKVLDKNGETMKVDVDLPGRKVYAQIWKANVGRIELYYLDANIEENSVEDRDITAQL
YGGNLETRIQQEILLGIGGIKALNKLGIKPTIYHMNEGHSAFLSLERMRQLMENNHLDKN
AAREVVYSSNVFTTHTPVPAGNDVFPIDMVQKYFSEYVKHIGMSMDEFLRLGRINPDDNK
ENFCMTVLALNLSAENNGVSLLHGHVSRAMWKDIWKGVPEDELPIDAITNGIHTLSWISF
DMQNLLDRYLGPRWRTKPLEHEVWERVQRIPDAELWKTHERRKERLIDFCRTRLKSQITN
RGFTKNEIEHADQILSPDALTIGFARRFATYKRGTLLFRDLDRLKKILSNKDKPVQIIFA
GKAHPHDNGGKELIREISEICRREDFRDHIVFLEDYDINVARYMVQGVDVWLNNPRRPLE
ASGTSGMKVPPNGGLNFSVLDGWWDEAYDAQNGWAIGNREQYSDLEYQDDVESKAIYNVL
ENEIIPLYYNNRGRDDIPREWVAAMKWSMQTVCPVFSTNRMVADYYNKFYNKASKRYLHM
IKNDFEKPKALKEWKQNIYDKWSKVSFENTISEMPSRNLKVGSKFEIKTIVNLGDIAPDS
VRVELYYGKLSMKEEIIEPSIIEMKHSADLGNGRHSFSGALVCNNSGQSGFAIRMYPYNK
DLSYKFDMKLIIWS
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagtaaatacatggtttcaccttctgtgccaaaagagttagaaccattgatg
gagataactaaaaacttttggtgggtttggaatcagaaagcaattaatttgttgaggaac
atagatattgacaactgggataaaaaagaccataatcctataagacttttaggggaatct
tcacaagaatgtttcgatactatgcttcatgatgatgcagctatgatgaacttagctgaa
gtttatgatgagtttaagacatatatgaatcaagaaacttggtatgatagtttagatgat
tctcaaaaaactaaaaatgaaaagattgcgtatttttcttttgaatatggattgcatgaa
tctttgccgaattattccggcggtttaggaatattatctggagaccatttaaagtctgct
agtgatttaggtttgccttttgttgctgttggacttttatatagaaaaggttattttaga
cagtatttaaatgctgatggttggcagcaggaatatgatatagaaaatgacttttttaat
ttagcattagaaaaggttttagataaaaacggcgagacaatgaaagttgatgttgatttg
cctggaagaaaagtttatgctcaaatttggaaggctaatgttggaagaatagagctttat
tatttagatgctaatatagaagaaaatagtgtagaagacagagatattacagctcagctt
tacggcggtaatttagagactagaatacagcaagagatacttcttggtattggcggtatt
aaggcattaaacaaacttggtattaagcctactatttatcatatgaatgaaggacatagt
gcttttctttctttagagagaatgagacagcttatggaaaataatcatcttgataagaat
gcggcaagagaggttgtttatagttctaacgtatttacaacacatacacctgtacctgct
ggtaacgacgtatttcctatagatatggtacagaaatatttcagcgagtatgttaagcat
attggcatgtctatggacgagtttttaagacttggaagaattaaccctgatgacaataaa
gaaaatttctgtatgacagttttggcacttaatttatctgctgaaaataacggtgtaagc
ttgcttcatggtcatgtttcaagagctatgtggaaagatatatggaaaggagttccagaa
gatgagcttcctattgatgctattactaatggtattcatacattaagctggatttctttt
gatatgcaaaacttattagatagatatttaggtcctcgttggagaactaagcctttagag
catgaggtttgggaaagagtacaaagaatacctgatgctgaactttggaaaactcatgag
agaagaaaagagagattaattgatttctgcagaactagattaaaatctcaaattacaaat
agaggctttacaaaaaatgaaatagagcatgctgaccaaatattgtcgcctgatgcttta
actattggttttgcaaggagatttgctacatataaaagaggaactttattatttagagat
ttagatagattaaagaagatattgagcaataaagataaaccagtacagataatatttgct
ggtaaggcacaccctcatgataatggcggtaaagagcttattagagagatatctgaaatt
tgcagaagagaagattttagagatcatatagtatttttagaagactatgatattaatgta
gcaagatatatggttcagggtgtagatgtatggcttaataacccaagaagacctttagaa
gctagcggtacaagcggtatgaaagttccgcctaatggtggtttgaatttcagtgtatta
gatggttggtgggacgaagcttatgatgctcaaaatggttgggctattggtaatagagag
cagtattcagatttagagtatcaagatgatgttgaaagtaaagctatatataatgtatta
gaaaatgagattattcctctttattataataacagaggaagagatgatatacctcgtgaa
tgggttgctgctatgaaatggagtatgcaaactgtttgtcctgtgttctctacaaataga
atggttgctgattattataataagttctataataaagcaagcaaaagatatttgcatatg
attaaaaatgactttgaaaagcctaaagcattaaaagaatggaaacaaaatatatatgat
aaatggtctaaggtttcttttgaaaatactatttctgagatgccttcaagaaatttaaaa
gttggaagcaaatttgaaataaaaactatagtaaatcttggagatatagcacctgattct
gtgagagttgagctttattatggtaaattaagcatgaaagaagagattatagagccttct
ataattgaaatgaaacattctgctgatttaggtaatggaagacattcatttagcggagct
ttagtatgtaacaatagcggacagagtggttttgctataagaatgtacccatacaataaa
gatttgagttacaaatttgatatgaagcttattatttggagctaa

DBGET integrated database retrieval system