KEGG   Brachyspira pilosicoli P43/6/78: BPP43_03220Help
Entry
BPP43_03220       CDS       T02387                                 

Definition
(GenBank) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
bpip00040  Pentose and glucuronate interconversions
bpip00051  Fructose and mannose metabolism
bpip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BPP43_03220
   00051 Fructose and mannose metabolism
    BPP43_03220
Enzymes [BR:bpip01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     BPP43_03220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AGA65950
UniProt: A0A3B6VJ60
LinkDB All DBs
Position
complement(678478..679521)
Genome map
AA seq 347 aa AA seqDB search
MEGKMKVAIMTDLKKIEFTEREIPKPKNDEVLVKLEYIGVCGSDLHYYEHGAIGNFIVKT
PFVLGHECSGTVVEIGEKVKHLKVGDRVALEPGKTCGECEFCRTGRYNLCPDVIFFATPP
VDGVFQEYVAHPESLSFKLPEKISTVEGALIEPLAVGMHAARQGNATIGQTAFVTGTGCI
GLCSMLALKACGISKVYVIDVIKKRLDKALELGATGVIDASKEDVVKRVLELTDGKGSDL
TIETAGVEATTNQAIQFAKKGSTIVLVGYSKTGMINMNVGMSLDKELTFKTVFRYRHMFP
LCIDAIESGAINIKNIVTNTYNFNDLQKGLDDSVNDKANIVKTVIKM
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtaaaatgaaagtcgcaataatgactgatctaaaaaagatagaatttacagaa
agagaaataccaaaacctaaaaatgatgaagtattagttaaattggaatatattggagta
tgcggttccgatttacactattatgaacatggtgctattggtaattttattgtgaagaca
ccttttgttttaggtcatgaatgtagcggcactgtagtagaaataggtgaaaaagtaaaa
catttaaaagttggtgatagggttgctttagaaccaggaaaaacttgcggtgaatgtgaa
ttttgcaggacaggaagatataatttatgtccagatgttatcttttttgcaactcctcca
gtagatggagtatttcaagagtatgttgctcacccagaatcattgtctttcaaattgcca
gaaaaaatttctacagttgaaggagctttgatagaacctttagcagttggaatgcatgct
gctagacaaggtaatgccacaataggacaaactgcatttgttactggtactggatgtatt
ggtctatgttctatgttagctttaaaagcttgtggaatatcaaaagtatatgttatagat
gttataaaaaaacgtttggataaggctttagaattaggagcaactggagttatagatgcc
tctaaagaagatgtagtaaaaagagttttagagttaacagatggtaagggaagcgatctt
actatagaaactgctggtgttgaggcaacaacaaatcaggctatacaatttgcaaaaaaa
ggctctactatagttttagttggatatagtaagacaggaatgataaacatgaatgttggt
atgtctttagataaagaattaacattcaaaacagtatttagatacagacatatgttccca
ttatgtatagatgctatagaaagcggagctattaatattaaaaatatagttactaatact
tataactttaatgatttacagaagggattagatgatagtgttaatgataaagctaatata
gtaaaaacagtaataaaaatgtaa

DBGET integrated database retrieval system