KEGG   Brachyspira pilosicoli P43/6/78: BPP43_11115Help
Entry
BPP43_11115       CDS       T02387                                 

Definition
(GenBank) putative dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
bpip00564  Glycerophospholipid metabolism
bpip01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpip00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BPP43_11115
Enzymes [BR:bpip01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BPP43_11115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD Pyr_redox_3 Pyr_redox_2 FAD_binding_3 NAD_binding_8 HI0933_like Pyr_redox FAD_binding_2 GIDA Mqo Thi4 TrkA_N AlaDh_PNT_C Lycopene_cycl NAD_binding_9 FAD_oxidored Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AGA67383
LinkDB All DBs
Position
complement(2323503..2324942)
Genome map
AA seq 479 aa AA seqDB search
MYDVLIIGAGVSGTSAARELSRYKANICVVERGEDVCSGTSKSNSGIVHAGFDAANGSLM
AKLNVLGNKMMKKIAEDLDVPFKQNGSLVVCTNEEDMPNLQAIYERGIKNGVEGLQILNR
EEVHKKEPNLNDNVCAALYAPTGGIVDPFILNIAYAENAHANGVEFKFYTEVINIKKLSD
GTFEVETNNGTIKAKYIVNAAGVYADKFHNMMSKNKIHITPRRGDYILLDKEVDNLVTST
IFALPTKLGKGILVTPTAHGNIMLGPTAIDIEDKEGLNTTAEGLAQIIEKSKMTVKNIPY
NKVITSFCGLRPHEDNHEFIIKEIEDCEGFFDCAGIESPGLVSSPAIGVMVADIVSKKGN
FEKKENFIEKRKGITHFNALSNKEKNKLIKENPLYGHIICRCEKVTEGEIVEAIKSPIGA
KSIDGVKRRVRAGLGRCQGGFCSPKIIEILARELNVSPITITKCGKGSEIVIGYDKETF
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatgtattgattataggtgctggtgtatctggtacttctgcggcacgcgagctt
tcaagatataaagctaatatatgtgttgttgagagaggtgaagatgtttgctctggtact
tcaaaatctaatagcggaatagtgcatgctgggtttgatgctgctaatggttcacttatg
gctaagctaaatgtattaggaaataagatgatgaaaaaaatagcagaagaccttgatgtg
cctttcaaacaaaatggttcattggtagtttgtactaatgaagaggatatgcctaattta
caggctatatatgaaagaggaataaaaaatggagttgaaggacttcagatattaaacaga
gaagaggttcataaaaaagagcctaacttaaatgataatgtatgtgcggcattgtatgct
cctactggaggaatagttgatccttttatattaaatattgcttatgctgaaaatgcccat
gctaatggagtagagtttaagttttacactgaagtaattaatataaaaaaactctctgac
ggcacttttgaagtagaaactaataatggcactataaaagcaaaatatattgtaaatgcg
gcaggtgtttatgctgataagtttcataatatgatgagtaaaaataaaatacatataact
cctagaagaggcgattatattttgttagacaaagaagttgataatcttgttacttctaca
atatttgctcttcctacaaaactaggtaaaggtattttagttactcctacagctcatggc
aatataatgcttggacctactgcaattgatatagaagataaagagggattaaacactact
gctgaaggacttgcacaaattatagagaaatcaaaaatgacagtaaaaaatattccttac
aataaagttattacttctttctgcgggcttcgtcctcatgaggataatcatgagtttatt
ataaaagagattgaagactgcgaaggattttttgactgtgctggaatagaatctcctgga
cttgtttcttctcctgctataggagtgatggttgctgatatagtaagtaaaaaaggaaac
ttcgagaagaaagaaaactttatagaaaagagaaaaggaataactcattttaatgctctt
tctaataaagagaaaaataaacttataaaagaaaatcctttatatgggcatattatttgc
agatgcgagaaagtaacagaaggtgaaatagtagaagctataaaaagccctataggagct
aaatctattgacggagttaaaaggcgtgtacgtgctggacttggaagatgccagggagga
ttctgttctcctaagataatagagatattagctagagaacttaatgtttcacctataact
attacaaaatgcggtaaaggttctgaaatagttattggttatgacaaggaaactttttaa

DBGET integrated database retrieval system