KEGG   Brachyspira pilosicoli B2904: B2904_orf1254Help
Entry
B2904_orf1254     CDS       T02225                                 

Definition
(GenBank) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
bpj00040  Pentose and glucuronate interconversions
bpj00051  Fructose and mannose metabolism
bpj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B2904_orf1254
   00051 Fructose and mannose metabolism
    B2904_orf1254
Enzymes [BR:bpj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     B2904_orf1254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AFR70591
UniProt: J9UGB9
LinkDB All DBs
Position
1293837..1294880
Genome map
AA seq 347 aa AA seqDB search
MEGKMKVAIMTDLKKIEFTEREIPKPKNDEVLVKLEYIGVCGSDLHYYEHGAIGNFIVKT
PFVLGHECSGTVVEIGEKVKHLKVGDRVALEPGKTCGECEFCRTGRYNLCPDVIFFATPP
VDGVFQEYVAHPESLSFKLPEKISTVEGALIEPLAVGMHAARQGNATIGQTAFVTGTGCI
GLCSMLALKACGISKVYVIDVIKKRLDKALELGATGVIDASKEDVVKRVLELTDGKGSDL
TIETAGVEATTNQAIQFAKKGSTIVLVGYSKTGMINMNVGMSLDKELTFKTVFRYRHMFP
LCIDAIESGAINIKNIVTNTYNFNDLQKGLDDSVNDKANIVKTVIKM
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtaaaatgaaagtcgcaataatgactgatctaaaaaagatagaatttacagaa
agagaaataccaaaacctaaaaatgatgaagtattagttaaattggaatatattggagta
tgcggttccgatttacactattatgaacatggtgctattggtaattttattgtgaagaca
ccttttgttttaggtcatgaatgtagcggcactgtagtagaaataggtgaaaaagtaaaa
catttaaaagttggtgatagagttgctttagaaccaggaaaaacttgcggtgaatgtgaa
ttttgcaggacaggaagatataatttatgtccagatgttatcttttttgcaactcctcca
gtagatggagtatttcaagagtatgttgctcacccagaatcattgtctttcaaattgcca
gaaaaaatttctacagttgaaggagctttgatagaacctttagcagttggaatgcatgct
gctagacaaggtaatgccacaataggacaaactgcatttgttactggtactggatgtatt
ggtctatgttctatgttagctttaaaagcttgtggaatatcaaaagtatatgttatagat
gttataaaaaaacgtttggataaggctttagaattaggagcaactggagttatagatgcc
tctaaagaagatgtagtaaaaagagttttagagttaacagatggtaagggaagcgatctt
actatagaaactgctggtgttgaagcaacaacaaatcaggctatacaatttgcaaaaaaa
ggctctactatagttttagttggatatagtaaaacaggaatgataaacatgaatgttggt
atgtctttagataaagaattaacattcaaaacagtatttagatacagacatatgttccca
ttatgtatagatgctatagaaagcggagctattaatattaaaaatatagttactaatact
tataactttaatgatttacagaagggattagatgatagtgttaatgataaagctaatata
gtaaaaacagtaataaaaatgtaa

DBGET integrated database retrieval system