KEGG   Brachyspira pilosicoli B2904: B2904_orf1507Help
Entry
B2904_orf1507     CDS       T02225                                 

Definition
(GenBank) alpha glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
bpj00500  Starch and sucrose metabolism
bpj01100  Metabolic pathways
bpj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B2904_orf1507
Enzymes [BR:bpj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     B2904_orf1507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: AFR70842
UniProt: J9TXG7
LinkDB All DBs
Position
complement(1561847..1564411)
Genome map
AA seq 854 aa AA seqDB search
MKVSKYMVSPSVPKELEPLMEITKNFWWVWNQKAINLLRNIDIDNWDKKDHNPIRLLGES
SQECFDTMLHDDAAMMNLAEVYDEFKTYMNQETWYDSLDDSQKTKNEKIAYFSFEYGLHE
SLPNYSGGLGILSGDHLKSASDLGLPFVAVGLLYRKGYFRQYLNADGWQQEYDIENDFFN
LALEKVLDKNGETMKVDVDLPGRKVYAQIWKANVGRIELYYLDANIEENSVEDRDITAQL
YGGNLETRIQQEILLGIGGIKALNKLGIKPTIYHMNEGHSAFLSLERMRQLMENNHLDKN
AAREVVYSSNVFTTHTPVPAGNDVFPIDMVQKYFSEYVKHIGMSMDEFLRLGRINPDDNK
ENFCMTVLALNLSAENNGVSLLHGHVSRAMWKDIWKGVPEDELPIDAITNGIHTLSWISF
DMQNLLDRYLGPRWRTKPLEHEVWERVQRIPDAELWKTHERRKERLIDFCRTRLKSQITN
RGFTKNEIEHADQILSPDALTIGFARRFATYKRGTLLFRDLDRLKKILSNKDKPVQIIFA
GKAHPHDNGGKELIREISEICRREDFRDHIVFLEDYDINVARYMVQGVDVWLNNPRRPLE
ASGTSGMKVPPNGGLNFSVLDGWWDEAYDAQNGWAIGNREQYSDLEYQDDVESKAIYNVL
ENEIIPLYYNNRGRDDIPREWVAAMKWSMQTVCPVFSTNRMVADYYNKFYNKASKRYLHM
IKNDFEKPKALKEWKQNIYDKWSKVSFENTISEMPSRNLKVGSKFEIKTIVNLGDIAPDS
VRVELYYGKLSMKEEIIEPSIIEMKHSADLGNGRHSFSGALVCNNSGQSGFAIRMYPYNK
DLSYKFDMKLIIWS
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagtaaatacatggtttcaccttctgtgccaaaagagttagaaccattgatg
gagataactaaaaacttttggtgggtttggaatcagaaagcaattaatttgttgaggaac
atagatattgacaactgggataaaaaagaccataatcctataagacttttaggggaatct
tcacaagaatgtttcgatactatgcttcatgatgatgcagctatgatgaacttagctgaa
gtttatgatgagtttaagacatatatgaatcaagaaacttggtatgatagtttagatgat
tctcaaaaaactaaaaatgaaaagattgcgtatttttcttttgaatatggattgcatgaa
tctttgccgaattattccggcggtttaggaatattatctggagaccatttgaagtctgct
agtgatttaggtttgccttttgttgctgttggacttttatatagaaaaggttattttaga
cagtatttaaatgctgatggttggcagcaggaatatgatatagaaaatgacttttttaat
ttagcattagaaaaggttttagataaaaacggcgagacaatgaaagttgatgttgatttg
cctggaagaaaagtttatgctcaaatttggaaagctaatgttggaagaatagagctttat
tatttagatgctaatatagaagaaaatagtgtagaagacagagatattacagctcagctt
tacggcggtaatttagagactagaatacagcaagagatacttcttggtattggcggtatt
aaggcattaaacaagcttggtattaagcctactatttatcatatgaatgaaggacatagt
gcttttctttctttagagagaatgagacagcttatggaaaataatcatcttgataagaat
gcggcaagagaggttgtttatagttctaacgtatttacaacacatacacctgtacctgct
ggtaacgacgtatttcctatagatatggtacagaaatatttcagcgagtatgttaagcat
attggcatgtctatggacgagttcttaagacttggaagaattaaccctgatgacaataaa
gaaaatttctgtatgacagttttggcacttaatttatctgctgaaaataacggtgtaagc
ttgcttcatggtcatgtttcaagagctatgtggaaagatatatggaaaggagttccagaa
gatgagcttcctattgatgctattactaatggtattcatacattaagctggatttctttt
gatatgcaaaacttattagatagatatttaggtcctcgttggagaactaaacctttagag
catgaggtttgggaaagagtacaaagaatacctgatgctgaactttggaaaactcatgag
agaagaaaagagagattaattgatttctgcagaactagattaaaatctcaaattacaaat
agaggctttacaaaaaatgaaatagagcatgctgaccaaatattgtcacctgatgcttta
actattggttttgcaaggagatttgctacatataaaagaggaactttattatttagagat
ttagatagattaaagaagatattgagcaataaagataaaccagtacagataatatttgct
ggtaaggcacaccctcatgataatggcggtaaagagcttattagagagatatctgaaatt
tgcagaagagaagattttagagatcatatagtatttttagaagactatgatattaatgta
gcaagatatatggttcagggtgtagatgtatggcttaataacccaagaagacctttagaa
gctagcggtacaagcggcatgaaagttccgcctaatggtggtttgaacttcagcgtatta
gatggttggtgggacgaagcttatgatgctcaaaatggttgggctattggtaatagagag
cagtattcagatttagagtatcaagacgatgttgaaagtaaagctatatataatgtatta
gaaaatgagattattcctctttattataataacagaggaagagatgatatacctcgtgaa
tgggttgctgctatgaaatggagtatgcaaactgtttgtcctgtgttctctacaaataga
atggttgctgattattataataagttctataataaagcaagcaaaagatatttgcatatg
attaaaaatgactttgaaaagcctaaagcattaaaagaatggaagcaaaatatatatgat
aaatggtctaaggtttcttttgaaaatactatttctgagatgccttcaagaaatttaaaa
gttggaagcaaatttgaaataaaaactatagtaaatcttggagatatagcacctgattct
gtgagagttgagctttattatggtaaattaagcatgaaagaagagattatagagccttct
ataattgaaatgaaacattctgctgatttaggtaatggaagacattcatttagcggagct
ttagtatgtaacaatagcggacagagcggttttgctataagaatgtacccatacaataaa
gatttgagttacaaatttgatatgaagcttattatttggagctaa

DBGET integrated database retrieval system