KEGG   Burkholderia pseudomallei NCTC 13179: BBK_2863Help
Entry
BBK_2863          CDS       T02894                                 

Definition
(GenBank) penicillin-binding, 1A family protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
bpk  Burkholderia pseudomallei NCTC 13179
Pathway
bpk00550  Peptidoglycan biosynthesis
bpk01100  Metabolic pathways
bpk01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bpk00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BBK_2863
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BBK_2863
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bpk01003]
    BBK_2863
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpk01011]
    BBK_2863
Enzymes [BR:bpk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BBK_2863
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BBK_2863
Glycosyltransferases [BR:bpk01003]
 Polysaccharide
  Bacterial polysaccharide
   BBK_2863
Peptidoglycan biosynthesis and degradation proteins [BR:bpk01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BBK_2863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: AGZ26948
LinkDB All DBs
Position
1:3290210..3292732
Genome map
AA seq 840 aa AA seqDB search
MPIIKRPPSSRATNEHHYSLRRSPAGAYYTDDDDDDERAPRRTGRDGGSRTFGSRVALWF
AGLFATLLVVGALIVGYALVVMGPQLPSLDALTNYQPKVPLRVYSADHVLLGEFGEERRS
LVRFADIPDVMKKAVLAIEDYRFYEHGGVDFVGILRAGVADLLHGGARQGASTITMQVAR
NFFLSSEKTYTRKIYEMLLAYKIEKALTKDQILELYMNQIYLGQRAYGFAAAARVYFGKD
LKDVTLAEAAMLAGLPKAPSAYNPVVNPKRAKVRQEYILKRMLEIGYITQQQYDQAVKEE
IHVRTPGNQYAVHGEYVAEMVRQMMYAQYKDETYTRGLTVTTTINAADQEAAYQAVRRGI
MDYERRHGYRGPEGFVALPPAGDERDEAIDDALADHPDNGDLQSAVVLAVSPTAVDVQFV
GGATATINGAGLRFAAGALSARASAALKIKPGSIVRVMKDARSAWQIVQLPQVEGALVAV
APQDGAIRSLVGGFDFNKSKFNHVTQAWRQPGSSFKPFIYSASLEKGLGPATIINDAPLY
FPPSVPGGQPWEPKDDDQPDGPMPMRTALQRSKNLVSIRILASIGTSYAQDYVTQRFGFD
PAKTPPYLPMALGAGLVTPLQLAAGYAVFANGGFKVDPYLIAEVDDARGQALQKAQPVVA
GASATRTIDARNAYVMNSLLHTVATAGTGAGTNALGRGDLQGKTGTTNEAKDGWFAGYQQ
SLVAVAWMGFDQPKSLGSREFGAQLALPIWVNYMRTALNGVPEQQMAMPDGLTTIDGELY
YADRTPGAGFVASVDFNPAASPTVSANDALGSAGAAGLTPPPVTPEEKRQIIDMFEGNKP
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgcctattatcaaacgaccgccttcctcccgcgccacgaacgagcaccattattcgctg
cgacgctcgccggccggcgcctattacaccgatgacgacgatgatgacgagcgcgcgccg
cgccgcacgggccgcgacggcggctcgcgcacgttcggctcgcgcgtcgcgctgtggttc
gccgggctcttcgcgacgctgctcgtcgtcggcgcgctgatcgtaggctatgcgctggtg
gtgatggggccgcaactgccgtcgctcgacgcgctcacgaattaccagccgaaggtgccg
ctgcgcgtgtacagcgcggaccacgtgctgctcggcgaattcggcgaggagcgccgcagc
ctcgtgcgcttcgcggacatccccgacgtgatgaagaaggcggtgctcgcgatcgaggat
tatcgcttctacgagcacggcggcgtggatttcgtcggcatcctgcgcgccggtgtggcc
gatctgctgcatggcggcgcgcggcagggcgcgagcacgatcacgatgcaggtcgcgcgc
aacttcttcctgtcgagcgagaagacgtacacgcgcaagatctacgagatgctgctcgcg
tacaagatcgaaaaggcgctgacgaaggaccagatcctcgagctgtacatgaaccagatc
tatctgggccagcgcgcgtacggcttcgcggccgccgcgcgcgtgtatttcggcaaggac
ctgaaggacgtcacgctcgccgaggccgcgatgctcgcggggctgccgaaggcgccgtcc
gcgtacaacccggtcgtcaacccgaagcgcgcgaaggtgcgtcaggagtacatcctgaag
cggatgctggagatcggctacatcacgcagcagcagtacgatcaggcggtgaaggaggaa
atccacgtgcgcacgccgggcaaccagtacgcggtgcacggcgagtacgtcgccgaaatg
gtgcggcagatgatgtatgcgcagtacaaggacgaaacctacacgcgcggcctgaccgtc
acgacgacgatcaacgcggccgaccaggaagccgcgtaccaggcggtgcgccgcgggatc
atggattacgagcgccgccacggctatcgcgggccggaaggcttcgtcgcgctgccgccc
gccggcgacgagcgcgacgaggcgatcgacgacgcgctcgcggatcatcccgacaacggc
gatctgcagtcggccgtcgtgctcgccgtctcgccgacggcggtcgacgtgcagttcgtc
ggcggcgcgacggcgacgatcaacggcgccgggctgcgtttcgcggccggtgcgttgagc
gcgcgcgcgtcggccgcgctgaagatcaagccgggttcgatcgtgcgcgtgatgaaggac
gcgaggagcgcatggcagatcgtgcagttgccgcaggtcgagggcgcgctcgtcgcggtc
gcgccgcaggacggcgcgatccgctcgctcgtcggcggcttcgatttcaacaagagcaag
ttcaaccacgtgacgcaggcatggcggcagccgggctcgtcgttcaagccgttcatctat
tcggcgtcgctcgaaaagggcctcgggcccgcgacgatcatcaacgacgcgccgctctat
ttcccgccgagcgtgccgggcggccagccgtgggagccgaaggacgacgatcagccggac
ggcccgatgccgatgcgcaccgcgctgcagcgctcgaagaacctcgtgtcgatccggatt
ctggcgtcgatcggcacgtcgtatgcgcaggactacgtgacgcagcgcttcggcttcgat
cccgcgaagacgccgccgtatctgccgatggcgctcggcgcgggcctcgtcacgccgctg
cagctcgcggcgggctacgcggtgttcgccaacggcggcttcaaggtcgatccgtatctg
atcgccgaagtcgacgacgcgcgcgggcaggcgctgcaaaaggcgcagccggtggtcgcg
ggcgcgagcgcgacgcgcacgatcgacgcgcgcaacgcctacgtgatgaacagcctgctg
cacaccgtcgcgacggcgggcacgggcgccggcacgaacgcgctcggccgcggcgacctg
cagggcaagaccggcacgacgaacgaggcgaaggacggctggttcgccggctatcagcag
tcgctcgtcgccgttgcatggatgggcttcgatcagccgaagagtctcggcagccgtgaa
ttcggcgcgcagctcgcgttgccgatctgggtgaattacatgcgcaccgcgctcaacggc
gtgccggagcagcagatggcgatgccggacgggctgacgacgatcgacggcgagttgtat
tacgcggatcgcacgccgggcgcgggcttcgtcgcgagcgtcgatttcaatccggccgcg
agcccgaccgtgagcgcgaacgacgcgctcggctcggcgggcgcggcgggcctgacgccg
ccgcccgtgacgccggaggagaagcggcagatcatcgacatgttcgaaggcaacaagcct
tga

DBGET integrated database retrieval system