KEGG   Burkholderia pseudomallei NCTC 13179: BBK_3406Help
Entry
BBK_3406          CDS       T02894                                 

Gene name
sucB
Definition
(GenBank) sucB: dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bpk  Burkholderia pseudomallei NCTC 13179
Pathway
bpk00020  Citrate cycle (TCA cycle)
bpk00310  Lysine degradation
bpk00380  Tryptophan metabolism
bpk01100  Metabolic pathways
bpk01110  Biosynthesis of secondary metabolites
bpk01120  Microbial metabolism in diverse environments
bpk01130  Biosynthesis of antibiotics
bpk01200  Carbon metabolism
Module
bpk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BBK_3406 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    BBK_3406 (sucB)
   00380 Tryptophan metabolism
    BBK_3406 (sucB)
Enzymes [BR:bpk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BBK_3406 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AGZ29481
LinkDB All DBs
Position
1:complement(3942826..3944103)
Genome map
AA seq 425 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQVIATIDTEAKAGAAAAAAGAADVQPAAAPVAAPAPAAQPAAAAASSTA
AASPAASKLMAEKGIGAGDVAGSGRDGRITKGDVLSAGSAPKAAPAAAPAKAAAKPALPE
VKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAKY
KDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLV
VPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINP
PQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPAR
LLLDL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctttcggagtcggtttcggaagcgaccatg
ctgcagtggaagaagaagcccggcgaagccgtcgcgcaggacgaaatcctgatcgagctc
gagacggacaaggtcgtcctcgaagtgccggcgccggccgcgggcgtgctcgcgcaagtg
ctgcagaacgacggtgacacggtcgtcgccgaccaggtgatcgcgaccatcgacaccgaa
gcgaaggcaggcgccgccgcggcagcggcaggcgccgccgacgttcagccggccgccgct
cccgtcgccgcgccggcgcccgcagcacagccggccgccgccgccgcgtcgagcaccgcg
gccgcatcgcccgccgcgtcgaagctgatggccgagaagggcatcggcgccggcgacgtc
gccggctcgggccgcgacggccgcatcacgaagggcgacgtgctgtccgcgggcagcgcg
ccgaaggccgcgccggccgccgcgccggcgaaggccgccgcgaagccggcgctgccggaa
gtgaaggtgccggcatcggcgacgacgtggctcaacgaccgtccggagcagcgcgtgccg
atgtcgcgcctgcgcgcgcgcatcgccgagcgtctgctcgaatcgcagcagaccaacgcg
atcctcacgacgttcaacgaagtgaacatgcagccggtgatggacctgcgcgcgaagtac
aaggacaagttcgagaaggagcacggcgtgaagctcggcttcatgtcgttcttcgtgaag
gcggccgttcacgcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggcaacgac
atcgtctaccacggctacttcgacatcggcatcgcggtcggttcgccgcgcggcctcgtc
gtgccgatcctgcgcaacgcggatcagctgagcctcgccgagatcgagaagaagatcgcc
gaattcggccagaaggcaaaggacggcaagctgtcgatcgaggaaatgacgggcggcacg
ttctcgatctcgaacggcggcgtgttcggctcgatgctgtcgacgccgatcatcaacccg
ccgcagtcggcgatcctcggcgtgcacgcgacgaaggagcgcccggtcgtcgagaacggc
cagatcgtgatccgcccgatcaactatctcgcgctgtcgtacgaccaccggatcatcgac
ggtcgcgaagcggtgctgtcgctcgtcgcgatgaaggacgcgctcgaagatccggcgcgc
ctgctgctcgacctgtaa

DBGET integrated database retrieval system