KEGG   Burkholderia pseudomallei NCTC 13179: BBK_3407Help
Entry
BBK_3407          CDS       T02894                                 

Gene name
sucA
Definition
(GenBank) oxoglutarate dehydrogenase (succinyl-transferring), E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bpk  Burkholderia pseudomallei NCTC 13179
Pathway
bpk00020  Citrate cycle (TCA cycle)
bpk00310  Lysine degradation
bpk00380  Tryptophan metabolism
bpk01100  Metabolic pathways
bpk01110  Biosynthesis of secondary metabolites
bpk01120  Microbial metabolism in diverse environments
bpk01130  Biosynthesis of antibiotics
bpk01200  Carbon metabolism
Module
bpk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BBK_3407 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    BBK_3407 (sucA)
   00380 Tryptophan metabolism
    BBK_3407 (sucA)
Enzymes [BR:bpk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BBK_3407 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AGZ28154
LinkDB All DBs
Position
1:complement(3944238..3947102)
Genome map
AA seq 954 aa AA seqDB search
MSDVMKQFQLNSYLFGGNASYVEELYEAYLDNPASVPDNWREYFDALQNVPATDGSNASD
VAHNPIVESFAQRAKANAFIPRESGGNLATARKQVHVQSLISAYRFLGSQWANLDPLKRR
ERPAIPELEPAFYDFSEADLDQTFSASNLYFGFEQASLRDIVKGLRDTYCGTIGAEFMYI
SDPEQKRWWQERLESTRATPNFSADKKKHILNRLTAGEGLERYLHTKYVGQKRFSLEGGE
SFIAAMDEVVQHAGSKGVQEIVIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAG
DVKYHKGFSSDIATEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDADGLQVLPVQ
IHGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDARSTLYCTDVVK
MIEAPVLHVNGDDPEAVVLATQIAIDYRMQFHKDVVIDIVCFRKLGHNEQDTPAVTQPLM
YKKIAQHPGTRALYAEKLVQQGVISADDADGFVKAYRKAMDDGHHTVDPVLSNYKSKYAV
DWMPFLNRKWTDAADTAVPLAELKRLGERITTVPENFKVHPLVERVINDRRNMARGDQPL
DWGMGEHLAYASLVASGYAVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNVSE
GQAKFNVIDSVLSEEAVLGFEYGYSTAEPNTLVLWEAQFGDFANGAQVVIDQFISSGEVK
WGRVSGLTMLLPHGYEGQGPEHSSARIERYLQLCAEHNMQVVQPTTPAQIFHLLRRQMIR
LFRKPLIVATPKSLLRHKEAVSDLSELAKGSFQPVLGEVDGGIDAKKVKRVIACSGRVYY
DLVAHRREAKANDVAIVRIEQLYPFAHKQFEAEMKKYENATEVVWVQDEPQNQGPWFYVE
HHLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALVEGAFGRLKSASIAK
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaatgaagcagttccagctgaactcgtatctgttcggcggtaacgcttcg
tatgttgaagaactgtacgaagcttatttggataatccggcgtcggtgccggataactgg
cgcgaatatttcgacgcactgcagaacgtccccgcaaccgacggttcgaacgcgagcgac
gtggcccacaacccgatcgtcgaatcgttcgcccagcgcgcgaaagccaacgctttcatc
ccgcgcgaaagcggcggcaacctcgccaccgcccgcaagcaagtccacgttcagtccctc
atcagcgcgtatcgcttcctcggctcgcaatgggccaacctcgatcccctgaagcgccgt
gaacgccccgcgatccccgagctggaacccgcgttctacgatttctccgaagccgatctc
gaccagacgttcagcgcgagcaacctgtatttcgggttcgagcaagcgtcgctgcgcgac
atcgtcaaggggttgcgcgacacgtactgcggcacgatcggcgccgaattcatgtacatc
agcgatcccgagcagaagcgctggtggcaggagcgtctcgagtcgacccgcgcgacgccg
aatttctcggccgacaagaagaagcacatcctgaaccgcctgacggcgggcgaaggcctc
gaacgctatctgcacacgaagtacgtcggccagaagcgcttctcgctcgaaggcggcgag
agcttcatcgcggcgatggacgaagtcgtccagcacgcgggttcgaagggcgtgcaggaa
atcgtcatcggcatggcgcaccgcggccgtctgaacgtgctcgtgaacacgctcggcaag
atgccggcggatctgttcgccgaattcgaaggcaagcacgtcgacgacctgccggcgggc
gacgtgaagtatcacaagggcttctcgtccgatatcgcgacggaaggcggcccggtccac
ctgtcgctcgcgttcaatccgtcgcacctcgaaatcgtgaacccggtggtcgaaggttcc
gcgaaggcgcggatggatcgccgcggcgacgccgacggcctgcaggtgctgcccgtgcag
atccacggcgacgcggcgttcgcgggccagggcgtggtgatggaaacgctgaacctcgcg
cagacgcgcggttacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggc
ttcacgacctccgacccgcgcgacgcgcgctcgacgctgtactgcacggacgtcgtcaag
atgatcgaggcaccggtgctgcacgtgaacggcgacgatccggaagccgtggtcctcgcc
acgcagatcgcgatcgactaccggatgcagttccacaaggatgtcgtgatcgacatcgtc
tgcttccgcaagctcggccacaacgaacaggacacgccggccgtcacgcagccgctgatg
tacaagaagatcgcgcagcacccgggcacccgtgcgctgtacgcggagaagctcgtccag
cagggcgtgatcagcgccgacgacgcggacggcttcgtgaaggcgtaccgcaaggcgatg
gacgacggccaccacacggtcgatccggtgctgtcgaactacaagagcaagtacgcggtc
gactggatgccgttcctgaaccgcaagtggacggacgccgccgacaccgcggtgccgctc
gccgagttgaagcgcctcggcgaacgcatcacgacggtgccggaaaacttcaaggtccac
ccgctcgtcgagcgcgtgatcaacgatcgccgcaacatggcgcgcggcgaccagccgctc
gactggggcatgggcgagcacctcgcgtacgcgtcgctcgtcgcgtccggctacgcggtg
cgcctgacgggccaggattcgggccgcggcacgttcacgcaccgtcacgcggtgctgcac
gaccagaaccgcgagcgctggaacgacggcacgtacgtgccgctgcagaacgtctcggaa
ggccaggcgaagttcaacgtgatcgactcggtgctgtccgaagaggcggtgctcggcttc
gaatacggctactcgaccgccgagccgaacacgctcgtgctgtgggaggcgcagttcggc
gatttcgccaacggcgcgcaggtcgtgatcgaccagttcatctcgtcgggcgaagtgaag
tggggccgcgtgtcgggcctcacgatgctgctgccgcacggctatgaaggccaggggccg
gagcactcgtcggcgcgcatcgagcgctatctgcagctgtgcgcggagcacaacatgcag
gtcgtgcagccgacgacgcccgcgcagatcttccacctgctgcgccgccagatgatccgc
ctgttccgcaagccgctcatcgtcgcgacgccgaagtcgctgctgcgccacaaggaagcg
gtgtcggatctgtcggaactcgcgaagggctcgttccagccggtgctgggcgaagtcgac
ggcggcatcgacgcgaagaaggtcaagcgcgtgatcgcctgctcgggccgcgtgtattac
gacctcgtcgcgcatcgccgcgaagcgaaggcgaacgatgtcgcgatcgtgcggatcgag
cagctctatccgttcgcgcacaagcagttcgaggcggaaatgaagaagtacgagaacgcg
acggaagtggtctgggtgcaggacgagccgcaaaatcaggggccgtggttctacgtcgaa
caccacctgaaggaaggcatgaaggaagggcagaagctcgcgtacagcggccgcccggct
tccgcctcgccggccgtcggctattacgcgaagcactacgagcagcagaaggccctcgtc
gaaggcgcattcggccgcttgaagagcgcatcgatcgcgaaataa

DBGET integrated database retrieval system