KEGG   Burkholderia pseudomallei NCTC 13179: BBK_5041Help
Entry
BBK_5041          CDS       T02894                                 

Definition
(GenBank) dhsB: succinate dehydrogenase and fumarate reductase iron-sulfur family protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bpk  Burkholderia pseudomallei NCTC 13179
Pathway
bpk00020  Citrate cycle (TCA cycle)
bpk00190  Oxidative phosphorylation
bpk00650  Butanoate metabolism
bpk01100  Metabolic pathways
bpk01110  Biosynthesis of secondary metabolites
bpk01120  Microbial metabolism in diverse environments
bpk01130  Biosynthesis of antibiotics
bpk01200  Carbon metabolism
Module
bpk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bpk_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BBK_5041
   00650 Butanoate metabolism
    BBK_5041
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BBK_5041
Enzymes [BR:bpk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BBK_5041
    1.3.5.4  fumarate reductase (quinol)
     BBK_5041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4_4
Motif
Other DBs
NCBI-ProteinID: AGZ30661
LinkDB All DBs
Position
2:complement(1883508..1884215)
Genome map
AA seq 235 aa AA seqDB search
MADTRILDIYRYDPDDGRAPRMQRYELAPRAEDRMLLDVLGRVKAQDETLSYRRSCREGV
CGSDAMNINGRNGLACVTSMQALPREIVLRPLPGLPVVRDLIVDMTSFFNQYHSVRPYLV
NEGVPPERERLQTPQEREQLDGLYECILCACCSSACPSYWWNPDKFVGPAGLLQAYRFIV
DSRDDASAARLDDLEDPYRLFRCRTIMNCVDVCPKGLNPARAIGQIRTMLARRAV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggccgacacccgcattctcgacatctaccgctacgatccggacgacgggcgcgcgccg
cgcatgcagcgctatgagctcgcgccgcgcgcggaagaccggatgctgctcgacgtgctc
ggccgcgtgaaggcgcaggacgagacgctgtcgtatcgccgctcgtgccgcgagggcgtg
tgcggctccgacgcgatgaacatcaacggccgcaacgggctcgcctgcgtgacgagcatg
caggcgctgccgcgcgaaatcgtgctgcggccgctgccggggctgcccgtcgtgcgcgat
ctgatcgtcgacatgacgagcttcttcaatcagtaccattcggtccgcccgtatctcgtc
aacgaaggcgtgccgcccgaacgagagcgcctgcagacgccgcaagagcgcgagcagctc
gacggcctctacgaatgcatcctgtgcgcgtgctgctcgagcgcgtgcccgagctactgg
tggaatcccgacaagttcgtcgggccggcggggctgctgcaggcgtaccgcttcatcgtc
gattcgcgtgacgacgcgagcgccgcgcgcctcgacgatctcgaggacccgtaccggctg
ttccgctgccggaccatcatgaactgtgtcgatgtctgtccgaaaggcctgaacccggcg
cgcgcgatcggacagatccgcacgatgctcgcgcggcgcgcggtatag

DBGET integrated database retrieval system