KEGG   Burkholderia pseudomallei NCTC 13179: BBK_538Help
Entry
BBK_538           CDS       T02894                                 

Definition
(GenBank) phosphoribosyltransferase family protein
  KO
K00768  nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC:2.4.2.21]
Organism
bpk  Burkholderia pseudomallei NCTC 13179
Pathway
bpk00860  Porphyrin and chlorophyll metabolism
bpk01100  Metabolic pathways
Module
bpk_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:bpk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BBK_538
Enzymes [BR:bpk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.21  nicotinate-nucleotide---dimethylbenzimidazole phosphoribosyltransferase
     BBK_538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DBI_PRT Hol_Tox
Motif
Other DBs
NCBI-ProteinID: AGZ27487
LinkDB All DBs
Position
1:complement(662639..663025)
Genome map
AA seq 128 aa AA seqDB search
MLGRALEPLDVLAAFGGFEIAMIAGAFIEAAHARMAILVDGFIATSALLVADALAPAVRE
YCVFSHVSNEAGHRRMLEHLGGEPLLALDLRLGEGTGAALALPLVRAAAAFVNEMASFES
AGVANRDA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgggcgcgcgctcgagccgctcgacgtgctcgccgcgttcggcggcttcgagatc
gcgatgatcgcgggcgcgttcatcgaagcggcgcacgcgcgcatggcgattctcgtcgac
ggcttcatcgcgacgtcggcgctgctcgtcgccgacgcgctcgcgcccgcggtgcgcgaa
tactgcgtgttctcgcacgtatcgaacgaagcggggcatcggcgcatgctcgagcacctc
ggcggcgagccgctcctcgcgctcgacctgcgtctcggcgagggcacgggcgcagcgctc
gcgctgccgctcgtgcgcgcggcggcggcgttcgtcaacgagatggcgagcttcgaatcg
gcgggcgtggcgaaccgcgatgcgtga

DBGET integrated database retrieval system