KEGG   Burkholderia pseudomallei NCTC 13179: BBK_5459Help
Entry
BBK_5459          CDS       T02894                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
bpk  Burkholderia pseudomallei NCTC 13179
Brite
KEGG Orthology (KO) [BR:bpk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BBK_5459
Enzymes [BR:bpk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BBK_5459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: AGZ32284
LinkDB All DBs
Position
2:2404820..2405956
Genome map
AA seq 378 aa AA seqDB search
MPQTAEAPPQRAAERGETPALPATMRAVVCHGPRDYRLEQVPVPKPGPDEILTQVERVGI
CMGDIKTFRGAPSFWGDAVQPRYVKPPMIPGHEFVCRVVALGPGAERRGVKAGDRVISEQ
IVPCWSCRFCGHGQYWMCQKHDLYGFQNNVHGAMAEYMIFTKEAIVHRVPDSIPTDEAIL
IEPLSCSLHAADRANVGFDDVVVVAGAGTLGLGIIGAVRLRHPKQLIVLDMKPERAALAR
RMGADDVWNPAEENVIEKIRAITGGYGCDIYIEATGHHRAVGQGLAMLRKLGRFVEFSVF
NDEASVDWSIIGDRKELDVLGSHLGPYMYPRAIEFIASRRIDVRGIVTHTFPLSRFADAF
AVMERGEQSLKVVLDPRG
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgccacagacagccgaagcgccgccgcaacgcgcggccgagcgcggcgagacgcccgcg
ctgcccgccacgatgcgcgccgtggtttgccacggcccgcgagactaccgcctcgagcag
gtgccggtgccgaagccggggccggacgagatcctgacccaggtggagcgcgtgggcatc
tgcatgggcgacatcaagacgtttcgcggcgcgccgtcgttctggggcgacgcggtgcag
ccgcgctacgtgaagccgccgatgattcccggccacgaattcgtgtgccgcgtcgtcgcg
ctcggccccggcgccgagcggcgcggcgtgaaggcgggcgatcgcgtgatctccgagcag
atcgtgccgtgctggagctgccgcttctgcggccacggccagtactggatgtgccagaag
catgatctgtacggattccagaacaacgtgcacggcgcgatggccgaatacatgatcttc
acgaaggaggcgatcgtgcaccgcgtgcccgattcgatcccgaccgacgaggcgatcctg
atcgagccgctgtcgtgctcgctgcacgcggccgatcgcgcgaacgtcggcttcgacgac
gtggtcgtcgtcgccggcgcgggcacgctcgggctcggcatcatcggcgcggtgcggctg
cgccatccgaagcaactgatcgtgctcgacatgaagcccgagcgcgcggcgctcgcgcgc
cggatgggcgcggacgacgtgtggaacccggccgaggagaacgtgatcgagaagatccgc
gcgatcacgggcggctacggctgcgatatctacatcgaggcgaccggccaccatcgcgcg
gtaggccaggggctcgcgatgctgcgcaagctcgggcgcttcgtcgagttcagcgtgttc
aacgacgaagcgagcgtcgactggtcgatcatcggcgatcgcaaggagctcgacgtgctc
ggctcgcatctcggcccgtacatgtacccgcgcgcgatcgagttcatcgcatcgcgcagg
atcgacgtgcgcggcatcgtcacgcacacgttcccgctgtcgcgcttcgccgacgcgttc
gccgtgatggagcgcggcgagcaatcgttgaaggtcgttctggatccgcgaggttaa

DBGET integrated database retrieval system