KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_2184Help
Entry
BURPS1106A_2184   CDS       T00480                                 

Definition
(GenBank) aldehyde dehydrogenase (NAD) family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00010  Glycolysis / Gluconeogenesis
bpl00053  Ascorbate and aldarate metabolism
bpl00071  Fatty acid degradation
bpl00280  Valine, leucine and isoleucine degradation
bpl00310  Lysine degradation
bpl00330  Arginine and proline metabolism
bpl00340  Histidine metabolism
bpl00380  Tryptophan metabolism
bpl00410  beta-Alanine metabolism
bpl00561  Glycerolipid metabolism
bpl00620  Pyruvate metabolism
bpl00625  Chloroalkane and chloroalkene degradation
bpl00903  Limonene and pinene degradation
bpl01100  Metabolic pathways
bpl01110  Biosynthesis of secondary metabolites
bpl01120  Microbial metabolism in diverse environments
bpl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS1106A_2184
   00053 Ascorbate and aldarate metabolism
    BURPS1106A_2184
   00620 Pyruvate metabolism
    BURPS1106A_2184
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BURPS1106A_2184
   00561 Glycerolipid metabolism
    BURPS1106A_2184
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BURPS1106A_2184
   00310 Lysine degradation
    BURPS1106A_2184
   00330 Arginine and proline metabolism
    BURPS1106A_2184
   00340 Histidine metabolism
    BURPS1106A_2184
   00380 Tryptophan metabolism
    BURPS1106A_2184
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BURPS1106A_2184
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BURPS1106A_2184
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BURPS1106A_2184
Enzymes [BR:bpl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BURPS1106A_2184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABN89731
UniProt: A3NVS7
LinkDB All DBs
Position
I:complement(2169701..2171137)
Genome map
AA seq 478 aa AA seqDB search
MKTCEQFYIGGAWRPSTGKGMIDVIDSGTEAVIGRVPEGTAEDAKAAVAAARAAFDGWAA
TPPAERARYLHKITENLKARSEELAQSITGEVGMPIKLSRAIQVGGPIYNWGAYAKLAET
FAFEEQVGNSLVVREPVGVVAAITPWNYPLNQITLKVAAALAAGCTVALKPSEVAPLNAF
ILAEAIHDAGLPAGVFNLVCGYGPVVGEALASDADVDMVSFTGSTRAGKRVAELAAAGVK
RVALELGGKSASVILDDADFAAAVKGTVSACYLNAGQTCSAHTRMLVPESRYEEARDLAK
AAAQAYVAGDPRDDATRLGALASSVQQKRVQDYIRRGIDEGAELVTGGLGMPEGITRGFF
VKPTVFGRVKPDATIAQEEIFGPVLSILTYRDEDDAVRIANDSPYGLGGAVWAGSDERAM
RVARRIRTGQVDINGGAWNMAAPFGGFKQSGIGRENGVYGLDEYLEYKSMQLRPHKRA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctgcgaacagttctacatcggcggtgcatggcgcccgagcacgggcaagggc
atgatcgacgtgatcgactccggcaccgaggccgtgatcggccgcgtccccgaaggcacc
gccgaagacgcgaaagcggccgtcgcggccgcgcgcgcggcgttcgacggctgggccgcg
acgccgcccgccgagcgcgcccgctatctgcacaagatcaccgagaacctgaaggcgcgc
agcgaggagctcgcgcaatcgatcacgggcgaagtcggcatgccgatcaagctgtcgcgc
gcgatccaggtcggcgggccgatctacaactggggcgcgtatgcgaaactcgccgagacc
ttcgcgttcgaggagcaggtgggcaattcgctcgtcgtgcgcgagcctgtcggcgtcgtc
gcggcgatcacgccctggaactatccgctcaaccagatcacgctgaaggtcgcggccgcg
ctcgcggcgggctgcacggtcgcgctgaagccgtccgaggtcgcaccgctcaatgcgttc
atcctcgccgaggcgattcacgacgcggggctgcccgccggcgtgttcaatctcgtgtgc
ggctacgggcccgtcgtcggcgaggcgctcgcgagcgacgccgatgtcgacatggtgtcg
ttcaccggctcgacgcgcgcgggcaagcgcgtcgccgagctcgccgcggccggcgtgaag
cgcgtcgcgctcgaactgggcggcaaatcggcgtcggtgattctcgacgacgccgatttc
gcggccgcggtgaagggcacggtgtccgcgtgctatctgaacgccgggcagacgtgttcc
gcgcatacgcgcatgctcgtgcccgaatcgcgctacgaggaggcgcgcgacctcgcgaag
gccgccgcgcaagcctatgtcgcgggcgatccgcgcgacgacgcgacgcggctcggcgcg
ctcgcgtcgtcggtccagcaaaagcgcgtgcaggattacatccggcgcggcatcgacgaa
ggcgcggagctcgtcacgggcggcctcggcatgccggagggcatcacgcgcggcttcttc
gtgaagccgaccgtgttcgggcgcgtgaagcccgacgcgacgatcgcgcaggaggagatc
ttcggcccggtgctgtcgattctcacgtatcgcgacgaggatgacgcggtgcgcatcgcg
aacgattcgccgtacgggctcggcggcgcggtgtgggcgggcagcgacgagcgcgcgatg
cgcgtcgcgcgccgcatccgcacggggcaggtcgatatcaacggcggggcatggaacatg
gccgcgccgttcggcggtttcaaacagtcgggcatcggccgcgagaacggcgtgtacggc
ctcgacgaatatctcgaatacaaatcgatgcaattgcgcccgcacaagcgcgcgtga

DBGET integrated database retrieval system