KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_4008Help
Entry
BURPS1106A_4008   CDS       T00480                                 

Gene name
eutE
Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00010  Glycolysis / Gluconeogenesis
bpl00620  Pyruvate metabolism
bpl01100  Metabolic pathways
bpl01110  Biosynthesis of secondary metabolites
bpl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS1106A_4008 (eutE)
   00620 Pyruvate metabolism
    BURPS1106A_4008 (eutE)
Enzymes [BR:bpl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BURPS1106A_4008 (eutE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABN91296
UniProt: A3P0V6
LinkDB All DBs
Position
I:3911694..3913313
Genome map
AA seq 539 aa AA seqDB search
MHRGAACWHGFGVTNGVAHVARRITDTDMRGATMNHADMQHLNIEFPYRKQYGNFIGGEW
VAPVGGEYFDNVSPVTGRPFTAIPRSREADIELALDAAHAAKAGWAAKGAAERANVLLRI
ADRMEANLTRLAVAETIDNGKPLRETTAADVPLAIDHFRYFAGCIRAQEGSIADIGGDMV
AYHFHEPLGVVGQIIPWNFPLLMAAWKLAPALAAGNCVVLKPAEQTPASILVFAELIQDL
LPPGVLNIVNGFGLEAGKPLASSKRIAKIAFTGETSTGRLIMQYASENLIPVTLELGGKS
PNIFFADVMDRDDSYFDKALEGFAMFALNQGEVCTCPSRALVEESIYDRFIERALKRVEA
IKQGHPLDSQTMIGAQASAEQLEKILSYIDIGRGEGAQCLTGGERNVLGGELAEGYYVKP
TVFRGHNKMRIFQEEIFGPVLAVTTFKTEEEALEIANDTLYGLGAGVWTRDGNRAYRFGR
GIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMMLDHYQQTKNLLVSYSEKPLGFF
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcggcgcggcgtgctggcacggttttggcgtaacgaacggcgtcgcgcacgtc
gcgcggcgcatcaccgataccgacatgcgaggagcaacgatgaatcacgcggacatgcaa
catctgaacatcgaattcccgtaccgcaagcagtacgggaatttcatcggcggcgaatgg
gtcgccccggtcggcggcgagtatttcgacaacgtctcgcccgtcaccggccggccgttc
accgcgatccctcgctcgcgcgaagccgacatcgagctcgcgctcgacgccgctcacgcg
gccaaggcgggctgggccgcgaagggcgcggccgagcgcgcgaacgtgctgctgaggatc
gccgaccggatggaggcgaacctcacgcgcctcgccgtcgccgagacgatcgacaacggc
aagccgctgcgcgaaaccaccgcggccgacgtgccgctcgcgatcgaccacttccgctac
ttcgcgggctgcatccgcgcgcaggaaggctcgatcgccgatatcggcggcgacatggtg
gcctaccacttccacgagccgctcggcgtcgtcggccagatcatcccgtggaacttcccg
ctgctgatggccgcgtggaagctcgcgccggcgctcgcggccggcaactgcgtcgtgctc
aagccggccgagcagacgcccgcgtcgatcctcgtgttcgccgagctgatccaggatctg
ctgccgcccggcgtgctcaacatcgtcaacggcttcggcctcgaggccggcaagccgctc
gcgtcgagcaagcggatcgcgaagatcgcgttcacgggcgagacgtcgacgggccgcctc
atcatgcagtacgcgagcgagaacctgattcccgtcacgctcgagctgggcggcaagagc
ccgaatattttcttcgccgacgtgatggatcgcgacgacagctacttcgacaaggcgctc
gaaggcttcgcgatgttcgcgctgaaccagggcgaagtctgcacgtgcccatcgcgcgcg
ctcgtcgaggagagcatctacgatcgcttcatcgaacgcgcgctcaagcgcgtcgaggcg
atcaagcagggccatccgctcgattcgcagacgatgatcggcgcgcaggcgtcggccgag
cagctcgagaagatcctgtcgtacatcgacatcggccgcggcgaaggcgcgcaatgcctg
acgggcggcgagcgcaacgtgctcggcggcgagctcgccgaaggctattacgtgaagccg
accgtgttccgcggccacaacaagatgcgcatcttccaggaagaaatcttcgggccggtg
ctcgcggtgacgacgttcaagaccgaggaggaagcgctcgagatcgcgaacgacacgctg
tacggcctgggcgccggcgtctggacgcgcgacggcaaccgcgcgtaccgcttcggccgc
ggcatccaggcgggccgcgtgtggacgaactgctatcacgcgtatccggcgcacgcggcg
ttcggcggctacaagcaatccggcatcggccgcgagacgcacaagatgatgctcgaccac
taccagcagacgaagaacctgctcgtcagctacagcgaaaagccgctcgggttcttctga

DBGET integrated database retrieval system