KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A0237
Entry
BURPS1106A_A0237  CDS       T00480                                 

Definition
(GenBank) OmpA family protein
  KO
K11892  type VI secretion system protein ImpK
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BURPS1106A_A0237
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpl02044]
    BURPS1106A_A0237
Secretion system [BR:bpl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1106A_A0237
SSDB
Motif
Pfam: DotU OmpA RskA
Other DBs
NCBI-ProteinID: ABN94735
UniProt: A3P1S0
LinkDB
Position
II:complement(225273..226538)
AA seq 421 aa
MHHPDISAPAPTFDSVAATLARREPAPAPAGEPPAARLAAIRLARNPLLEAARVLLRALA
DMPERLDRDDIPQLRLLLEQEVRLFQRLCEQANIRRDHMLGARYCLCTALDEAAMQTSWA
QSASGNLGTWISEGLATSFHEDRQGGDKVYLLIGRLMNSPHEHIDLLEVIYRILSLGFEG
RYRYEADGQRKHETVRQRLYNEIASQRGPVSVALSPHWQPGPRSRSAPFRDFPAWVTAAV
LSLIALGLFGCFKYALSTRSADVQQRIAAIARMAPPAAPAELRLATLLAGEIAAGTLSVE
ENARRSSVTFRGDAMFAPGAAGVNPAMGPLIRKIAAEIAKVPGKVTVRGYTDNQPIKSRQ
FASNEALSEERATQVMQMLQSAGVPASRLEALGKGGAEPIGDNRTPQGRALNRRVEITVA
R
NT seq 1266 nt   +upstreamnt  +downstreamnt
gtgcatcatccggacatatcggctccggccccgaccttcgattccgtcgcggcgacgctc
gcgcggcgcgagccggcgcctgcgccggccggcgagccgcccgccgcgcgcctcgccgcg
atcaggctcgcccgcaacccgctgctcgaagccgcgcgcgtgctgctgcgggcgctcgcc
gacatgcccgagcggctcgatcgcgacgacattccgcaattgcgactgctgctggaacag
gaggtgcgcctgttccagcggctctgcgaacaggcgaacatccggcgcgaccacatgctc
ggcgcgcgctactgcctgtgcaccgcgctcgacgaggcggcgatgcagacgtcgtgggca
caatcggcgagcggcaatctcggcacgtggatcagcgaggggctcgcgacgtcgttccac
gaggatcgccagggcggagacaaggtctatctgctgatcggccggctgatgaattcgccg
cacgagcacatcgacctgctcgaagtcatctatcgaatcttgagcctcggcttcgagggc
cgctaccgttacgaagccgacggccagcgcaagcacgagaccgtgcgccagcggctctac
aacgagatcgcatcgcagcgcgggccggtgtcggtcgcgctgtcgccgcactggcagccc
ggcccccgcagcaggagcgcgccgtttcgcgatttccccgcgtgggtcacggccgccgtg
ctgtcgctgatcgcgctcgggctgttcggctgcttcaagtacgcgctgtcgacgcgcagc
gccgacgtgcagcagcggatcgccgcgatcgcgcggatggcgccgcccgccgcgccggcc
gagctgcgcctcgcgacgctgctcgccggcgagatcgcggcgggcacgctcagcgtcgag
gaaaacgcgcgccgcagctcggtgacgttccgcggcgacgcgatgttcgcgccgggcgcg
gccggcgtgaacccggcgatggggccgctcatccggaaaatcgcggccgagatcgcgaag
gtgccgggcaaggtgacggtgcgcggctacaccgacaatcagccgatcaaaagccgccag
ttcgcgtcgaacgaggcgctatccgaagagcgcgcgacgcaggtcatgcagatgctccag
agcgcgggcgtgcccgcgagccgcctcgaggcgctcggcaagggcggcgccgagccgatc
ggcgacaaccggaccccgcagggccgcgcgctgaaccgccgcgtcgaaatcacggtcgcg
cgctga

DBGET integrated database retrieval system