KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A1653Help
Entry
BURPS1106A_A1653  CDS       T00480                                 

Definition
(GenBank) putative D-xylulose reductase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00040  Pentose and glucuronate interconversions
bpl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BURPS1106A_A1653
Enzymes [BR:bpl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     BURPS1106A_A1653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Sacchrp_dh_NADP Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ABN94389
UniProt: A3P5S7
LinkDB All DBs
Position
II:1621377..1622411
Genome map
AA seq 344 aa AA seqDB search
MKALVLEKARELALRDIDLPLEVGPADVKIRVHTVGVCGSDVHYYMHGGIGPFRVDAPMV
LGHEASGTVVEVGRDVTYLRVGERVCMEPGVPRFDSKATLHGLYNLDPSVRFWATPPVHG
CLAPYVVHPAAFTYRLPPNVSFAEGAIVEPLAIGLQAAKKAAMKPGDIAVVVGAGTIGAM
TALAALAGGAARVILADVVKEKLALFAANRAVTTVDASTQSLADAVAHATDGWGADVVFE
ASGNASAYAGIVDLLCPNGCLVLVGMPLAPVPLDVVSLQAKEARIESVFRYANVFPRALA
LIASGAIDVKPFISRTFPFSDGLRAFEAAASGQPHDVKIQIEMD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagccctcgtactcgaaaaggcgcgcgagctcgcgctgcgcgacatcgatctgccg
ctcgaggtcggccccgccgacgtcaagatccgcgtccacacggtgggcgtgtgcggcagc
gatgtccattactacatgcacggcggaatcggcccgttccgggtggacgcgccgatggtg
ctcggccacgaggcgtcgggcacggtcgtcgaggtcgggcgcgacgtcacgtacctgcgc
gtgggcgagcgcgtgtgcatggagcccggcgtgccgcgcttcgattcgaaagcgacgctg
cacggcctgtacaacctcgatccgtcggtgcgcttctgggcgacgccgcccgtgcacggg
tgcctcgcgccctacgtcgtgcacccggcggcgttcacgtaccggctgccgccgaacgtg
tcgttcgccgagggcgcgatcgtcgagccgctcgcgatcgggctgcaggccgcgaagaag
gcggcgatgaagccgggcgacatcgcggtggtcgtcggcgcgggcacgatcggcgcgatg
acggcgctcgccgcgctcgcgggcggcgccgcgcgcgtgatcctcgccgacgtcgtcaag
gaaaagctcgcgctgttcgccgcgaaccgcgcggtgacgacggtcgacgcgagcacgcag
tcgctcgccgatgcggtcgcgcacgcgaccgacggctggggcgcggacgtggtgttcgag
gcaagcggcaacgcgagcgcgtatgcgggcatcgtcgatctgctgtgcccgaacggctgc
ctcgtgctggtcggcatgccgctcgcgccggtgccgctcgatgtcgtttcgctgcaggcg
aaggaggcgcgcatcgaatcggtgttccgctacgcgaacgtcttcccgcgcgcgctcgcg
ctgatcgcctccggcgcgatcgacgtgaagccgttcatctcgcgcacgttcccgttctcg
gacggcctgcgcgcattcgaggcggcggcgagcggccagccgcacgacgtgaagattcag
atcgaaatggattga

DBGET integrated database retrieval system