KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A2563Help
Entry
BURPS1106A_A2563  CDS       T00480                                 

Definition
(GenBank) aromatic-ring-hydroxylating dioxygenase, alpha subunit
  KO
K16319  anthranilate 1,2-dioxygenase large subunit [EC:1.14.12.1]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00627  Aminobenzoate degradation
bpl01100  Metabolic pathways
bpl01120  Microbial metabolism in diverse environments
Module
bpl_M00637  Anthranilate degradation, anthranilate => catechol
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BURPS1106A_A2563
Enzymes [BR:bpl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     BURPS1106A_A2563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske Ring_hydroxyl_A
Motif
Other DBs
NCBI-ProteinID: ABN94502
UniProt: A3P8D3
LinkDB All DBs
Position
II:complement(2517574..2518851)
Genome map
AA seq 425 aa AA seqDB search
MEMTESPVALIDRADSSDVRFPRDDGSRVPYKVFSSQAVYEREQERIFRGPTWNFVALEA
EIPKPGDFKSTFVGDTPVVVTRGEDGALAAWVNRCAHRGAQVCRKARGNASSHTCVYHQW
SFDSRGDLLGVPFRRGQKGMAGMPADFDPKNHGLRKLRVDSYKGLVFATFSDEVAPLPDY
LGAQMRPWIDRIFHKPIEYLGCTRQFSKSNWKLYFENVKDPYHASMLHLFHTTFNIFRVG
MKARSIPDATHGLHSIITMTKTRDDADTASAYKQQNIRSFDEGFSLEDDSILGLVSEYDE
DTTNHIQPIFPQLVIQQIHNTLVARQLLPKGPKNFELIFHFFGYADDTPELRDLRIKQAN
LVGPAGYISMEDTEATELVQRGTVRDANAASVIEMSRGNPDQQDTAITESLIRRFWVGYQ
QLMGY
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgaccgaatcgccggtggcgctgatcgatcgcgccgattcgtccgacgtgcgc
tttccgcgcgacgacggctcgcgcgtgccgtacaaggtgttcagctcgcaggcggtgtac
gagcgcgagcaggagcggatcttccgcgggccgacgtggaatttcgtcgcgctcgaagcg
gaaattccgaagccgggcgatttcaagagcacgttcgtcggcgacacgcccgtcgtcgtc
acgcgcggcgaggacggcgcgctcgccgcgtgggtgaaccgctgcgcgcatcgcggcgcg
caggtgtgccgcaaggcgcgcggcaacgcgagctcgcacacgtgcgtgtatcaccagtgg
agcttcgacagccggggcgacctgctcggcgtgccgttccggcgcggccagaagggcatg
gccgggatgccggccgatttcgatccgaagaaccacgggctgcgcaagctgcgcgtcgac
agctacaagggcctcgtgttcgcgacgttcagcgacgaggtcgcgccgctgcccgattac
ctcggcgcgcagatgcggccgtggatcgaccggatcttccacaagccgatcgagtatctc
ggctgcacgcggcagttctcgaaatcgaactggaagctgtacttcgagaacgtgaaggac
ccgtatcacgcgagcatgctgcatctgttccatacgacgttcaatattttccgcgtcggc
atgaaggcgcgctcgattcccgatgcgacgcacgggctgcacagcatcatcacgatgacg
aagacgcgcgacgacgcggacaccgcgagcgcgtacaagcagcagaacatccgttcgttc
gacgaaggtttctcgctcgaggacgattcgatcctcggcctcgtatccgagtacgacgag
gacacgacgaaccacatccagccgatcttcccgcagctcgtgatccagcagatccacaac
acgctcgtcgcacgccagttgctgccgaaggggccgaagaacttcgaattgatcttccac
ttcttcggctatgcggacgacacgcccgagctgcgcgatttgcggatcaagcaggcgaac
ctcgtcgggcccgcgggctacatctcgatggaggacaccgaggcgaccgagctcgtgcag
cgcggcaccgtgcgcgacgcaaacgcggcgtcggtgatcgagatgtcgcgcggcaatccg
gaccagcaggacacggcgatcaccgagagcctgatccgcaggttctgggtcggctaccag
cagttgatgggctattga

DBGET integrated database retrieval system