KEGG   Burkholderia plantarii: bpln_1g02320Help
Entry
bpln_1g02320      CDS       T04139                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bpla  Burkholderia plantarii
Brite
KEGG Orthology (KO) [BR:bpla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bpla03012]
    bpln_1g02320
   03029 Mitochondrial biogenesis [BR:bpla03029]
    bpln_1g02320
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpla04147]
    bpln_1g02320
Translation factors [BR:bpla03012]
 Eukaryotic Type
  Elongation factors
   bpln_1g02320
 Prokaryotic Type
   bpln_1g02320
Mitochondrial biogenesis [BR:bpla03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    bpln_1g02320
Exosome [BR:bpla04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   bpln_1g02320
  Exosomal proteins of breast cancer cells
   bpln_1g02320
  Exosomal proteins of colorectal cancer cells
   bpln_1g02320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase Lsm_C
Motif
Other DBs
NCBI-ProteinID: ALK29063
UniProt: A0A0P0KYK8
LinkDB All DBs
Position
1:293925..295115
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSSKFGGEAKKYDEIDAAPEEKARG
ITINTAHIEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIIKGSAKLALE
GDKGELGETAIMNLADALDSYIPTPERAVDGTFLMPVEDVFSISGRGTVVTGRVERGIVK
VGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREEVERGQVLAKPGS
IKPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKILD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaaaatttgagcggaccaagccgcacgtcaacgtcggcacgatcggtcac
gttgaccacggcaagacgacgctgacggcggcgatcgcaacggttctgtcgtcgaagttc
ggcggcgaagcgaagaagtacgacgaaatcgacgcggcgccggaagaaaaggcacgcggc
atcacgatcaacactgcgcacatcgagtacgaaacggcgaaccgccactacgcacacgtc
gattgcccgggccacgccgactacgtgaagaacatgatcacgggtgccgcgcagatggac
ggcgcgatcctggtctgctcggcagccgacggcccgatgccgcaaacgcgtgagcacatt
ctgctggcgcgtcaggttggcgttccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgctgaactgctcgagctggtcgagatggaagttcgcgagctgctgtcgaag
tacgacttcccgggcgacgacaccccgatcatcaagggttcggcgaagctggcgctggaa
ggcgacaagggcgagctgggcgagacggcgatcatgaacctggccgacgcgctggactcg
tacatcccgacgccggagcgcgcggtggacggtacgttcctgatgccggtggaagacgtg
ttctcgatctcgggtcgcggcacggtggtgacgggtcgtgtcgagcgcggcatcgtgaag
gttggcgaggaaatcgaaatcgtcggtatcaagccgacggtgaagacgacctgcacgggc
gtggaaatgttccgcaagctgctggatcaaggccaggctggcgacaacgttggtatcctg
ctgcgcggcacgaagcgtgaagaagtggagcgtggtcaggttctggcgaagccgggctcg
atcaagccgcacacgcacttcacggctgaggtgtacgtgctgagcaaggatgaaggtggc
cgccacacgccgttcttcaacaactaccgtccgcagttctacttccgtacgacggacgtg
acgggttcgatcgagctgccgaaggacaaggaaatggtcatgccgggcgacaacgtgtcg
atcacggtgaagctgatcgctccgatcgcgatggaagaaggtctgcgcttcgcgatccgc
gaaggcggccgcaccgtcggcgccggcgtcgtcgccaagatcctcgactaa

DBGET integrated database retrieval system