KEGG   Burkholderia plantarii ATCC 43733: bpln_1g04360Help
Entry
bpln_1g04360      CDS       T04139                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bpla  Burkholderia plantarii ATCC 43733
Pathway
bpla00473  D-Alanine metabolism
bpla00550  Peptidoglycan biosynthesis
bpla01100  Metabolic pathways
bpla01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bpla00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    bpln_1g04360
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    bpln_1g04360
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    bpln_1g04360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpla01011]
    bpln_1g04360
Enzymes [BR:bpla01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     bpln_1g04360
Peptidoglycan biosynthesis and degradation proteins [BR:bpla01011]
 Precursor biosynthesis
  Amino acid ligase
   bpln_1g04360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_ST ATP-grasp ATP-grasp_3 TTL ATP-grasp_4 ATPgrasp_YheCD PPR
Motif
Other DBs
NCBI-ProteinID: ALK29265
UniProt: A0A0B6RNP7
LinkDB All DBs
Position
1:513364..514305
Genome map
AA seq 313 aa AA seqDB search
MSGIDPKRFGKVAVLLGGVTAEREVSLNSGRLVLQGLRDAGIDAHPFDPSERPLSALKDE
GFVRAFNALHGGYGENGQIQGALDFYGIRYTGPGVLGSALGLDKFRTKLVWQQTGIPTPP
FETVMRGDDVAARAPEIVAKLGLPLFVKPASEGSSVAVIKVKDAAALPAALDEAGRHDRI
VIVEKSIEGGGEYTACIAGDLDLPVIRIVPAGEFYDYHAKYLADDTQYLIPCGIDAAKET
EFKRLARRAFEVLGCSGWGRADFMLDAAGNPYFLEVNTAPGMTDHSLPPKAARAVGISYS
ELVVKVLSLTLED
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggatcgatccgaaacgtttcggcaaggtggcggtactgctcggcggcgtgacc
gccgagcgcgaggtatcgctgaattcgggcaggctggtgctgcagggcctgcgcgacgcg
ggcatcgacgcgcatccgttcgacccgtccgagcggccgctgtcggcgctgaaggacgag
ggcttcgtgcgcgcgttcaacgcgctgcacggcggctacggcgagaacggccagatccag
ggcgcgctcgatttctacgggatccgctacaccggtcccggcgtgctcggctcggcgctc
ggcctcgacaagttccgcaccaagctggtctggcagcagaccggcatcccgacgccgccg
ttcgagaccgtgatgcgcggtgacgacgtggccgcgcgtgcgccggaaatcgtcgcgaag
ctgggcctgccgctgttcgtgaagccggccagcgaaggctcgagcgtcgcggtgatcaag
gtgaaggacgccgccgcgctgccggccgcgctcgacgaggcgggccggcacgaccgcatc
gtgatcgtcgagaagagcatcgagggcggcggcgagtacacggcctgcatcgcgggcgac
ctggatctgccggtgatccgcatcgtgccggccggcgagttctacgactatcacgcgaaa
tacctcgccgacgacacgcagtacctgatcccgtgcgggatcgacgcggcgaaggaaacg
gaattcaagcggctcgcgcgccgcgcgttcgaggtgctcggctgcagcggctggggtcgc
gccgatttcatgctcgacgcggcgggcaacccgtatttcctggaagtgaacacggcgccg
gggatgaccgaccactcgctgccgccgaaggcggcgcgcgcggtcggcatcagctactcg
gagctggtggtgaaggtgttgtcgctgacgctcgaagactga

DBGET integrated database retrieval system