KEGG   Burkholderia plantarii ATCC 43733: bpln_1g10280Help
Entry
bpln_1g10280      CDS       T04139                                 

Definition
(GenBank) aspartate/alanine exchanger family protein
Organism
bpla  Burkholderia plantarii ATCC 43733
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp-Al_Ex TrkA_C
Motif
Other DBs
NCBI-ProteinID: ALK29850
UniProt: A0A0B6S030
LinkDB All DBs
Position
1:1202769..1204454
Genome map
AA seq 561 aa AA seqDB search
MTWLHNIFTRSPEIAFFLSLAIGYFIGQIKFGKFQLGGVGGSLLAAVVISQVGITIDNGV
KSVMFAVFIYAVGYESGPGFFNSLSRKTLREIAMAVFLAVSALFTVLICAKLFHLNKGLA
AGLAGGALTQSAIIGTAGDAISRLDLPLDQIKSLQADVAIGYAVTYVFGSLGSILVCVNI
LPKFMGRGLKEASQDAERELSGNRLAPAAGQTAALPELVGRVFRIEGAAGRTIQQVEVEH
GDLVTVETIRRHGKTVEPTPDFVLSNGDVVLLVGRREGMVGAAATIGAELQDGEDINIPM
QKRQGVFTRKGMNHTTLAEVRANVDRDLRHGVYVESATRAGQPLPVFADTELQHGDVITF
YGTPKDTKRAVDAAGYELPYTNKTDFIYMGTGIVLGLLLGLLVARVGGIPLTLGSGGGCL
VAGLLFGWMRGKHPMYGVMPTAASQLLKDIGLAGFVTVVGLNSGLQAVVTVKQSGMTIFL
LGIVVTVVPLILTMLFGRYVLRYRNAAILAGALAGSRSANPAFGGVLDKAESAIPTVPFA
ITYAIANVLLTLLGPLVVGLV
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgacctggttacacaacatattcacgagatcgccggagatagcgttcttcctatctctg
gccatcggctatttcatcggccaaatcaagttcggcaaattccagctgggcggcgtgggc
ggctcgttgctggccgccgtcgtgatcagccaggtgggcatcacgatcgacaacggcgtc
aagtcggtcatgttcgccgtgttcatttacgcggtcggctacgagtccggccccgggttc
ttcaattcgctgagccgcaagaccctgcgtgaaatcgcgatggcggtgtttctcgcggtg
agcgcgctgttcacggtgctgatctgcgcgaagctgttccacctgaacaaggggctggcc
gccgggctcgccggcggggcgctgacccagtcggccatcatcggcaccgccggtgacgcg
atctcgcgcctcgatctgccgctcgaccagatcaagtcgctgcaggcggacgtggcgatc
ggctacgccgtcacctatgtgttcggttcgctcggctcgatcctggtctgcgtgaacatc
ctgccgaagttcatgggccgcgggctcaaggaagcatcgcaggacgccgagcgcgagctg
tcgggcaaccgcctcgcgcccgccgcgggccagacggccgcgttgcctgagctggtgggc
cgggtgttccgcatcgaaggcgcggccggccgcacgatccagcaggtcgaggtggagcac
ggtgatctcgtgacggtcgagaccattcgccgtcacggcaagacggtcgagccgacgccc
gacttcgtgctgagcaacggcgacgtcgtgctgctggtggggcgccgcgaaggcatggtc
ggcgcagccgccacgatcggggccgagctgcaggacggcgaggacatcaacatcccgatg
cagaagcgccagggcgtgttcacgcgcaagggcatgaaccacaccacgctggccgaggtg
cgcgccaacgtcgatcgcgacctgcgccacggcgtgtacgtcgagagcgcgacgcgcgcc
ggccagccgctgccggtgttcgccgacaccgagctgcagcacggcgacgtcatcacgttc
tatggcaccccgaaggatacgaagcgcgctgtcgacgcggcaggttacgaacttccgtac
acgaacaagaccgacttcatctacatgggtaccggcatcgtgctgggcctcctgctgggc
ctgctggtggcgcgcgtcggcggcattccgctcacgctcggctcgggcggcggctgtctc
gtggccggcctgctgttcggctggatgcgcggcaagcacccgatgtacggcgtgatgccg
accgcggcctcgcagctgctgaaggacatcgggctggccggcttcgtcacggtggtcggg
ctgaactccggcctgcaggccgtcgtcacggtcaagcaaagcggcatgacgatcttcctg
ctcggcatcgtggtcacggtggtgccgctgatcctgaccatgctgttcggccgctacgtg
ctgcgctaccgcaacgcggcgatcctggccggtgcgctggccggctcgcgcagcgcgaac
cccgcgttcggcggcgtgctcgacaaggccgaaagcgcgattcccacggtgccgttcgcg
atcacctacgcgatcgccaacgtgctgctgacgctgctcggcccgctcgtggtcggcctc
gtctga

DBGET integrated database retrieval system