KEGG   Burkholderia plantarii: bpln_1g15880Help
Entry
bpln_1g15880      CDS       T04139                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bpla  Burkholderia plantarii
Pathway
bpla00020  Citrate cycle (TCA cycle)
bpla00310  Lysine degradation
bpla00380  Tryptophan metabolism
bpla01100  Metabolic pathways
bpla01110  Biosynthesis of secondary metabolites
bpla01120  Microbial metabolism in diverse environments
bpla01130  Biosynthesis of antibiotics
bpla01200  Carbon metabolism
Module
bpla_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpla_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpla00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    bpln_1g15880
  Amino acid metabolism
   00310 Lysine degradation
    bpln_1g15880
   00380 Tryptophan metabolism
    bpln_1g15880
Enzymes [BR:bpla01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     bpln_1g15880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N DUF2680
Motif
Other DBs
NCBI-ProteinID: ALK30399
UniProt: A0A0N7J1N2
LinkDB All DBs
Position
1:1887556..1890423
Genome map
AA seq 955 aa AA seqDB search
MSDVMKQFQLNSYLFGGNASYVEELYEAYLDNPASVPDNWREYFDALQNVPATDGSNAND
VAHNPIVESFAQRAKANAFIPRESSGGNLATARKQVHVQSLISAYRFLGSQWANLDPLKR
RERPAIPELEPAFYDFSEADLDQTFSASNLYFGFEQASLRDIVKSLRDTYCGTIGVEYMY
IGDPEQKRWWQERLESTRATPNFSADKKKHVLNRLTAAEGLERYLHTKYVGQKRFSLEGG
ESFIAAMDEVVQHSGSKGVQEIVIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPA
GDVKYHKGFSSDIATEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDADGLQVLPV
QIHGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDARSTLYCTDVV
KMIEAPVLHVNGDDPEAVVLAVQIAIDYRMQFHKDVVIDIVCFRKLGHNEQDTPAVTQPL
MYKKIAQHPGTRALYAEKLVQQGVITAEQGDEFVKAYRKAMDDGHHTVDPVLSNYKSKYA
VDWVPFLNRKWTDAADTAVPLAELKRIGERITTVPENFKVHPLVERVINDRRKMAQGDQP
LDWGMGEHLAFASLVSSGYAVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNVS
EGQANFTVIDSVLSEEAVLGFEYGYSTAEPNTLVLWEAQFGDFVNGAQVVIDQFISSGEV
KWGRVSGLTMLLPHGYEGQGPEHSSTRIERFLQLCADHNMQVVQPTTPAQIFHLLRRQMI
RLFRKPLIVATPKSLLRHKEAVSDLSELAKGSFLPVIGEVDETIDAKKVKRVIACSGRVY
YDIVAHRREAKAHDVAIVRIEQLYPFAHKQFEAEMKKYDNATEVVWVQDEPQNQGPWFYI
EHHLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALIEGAFGRLKSASIAK
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaatgaagcagttccagctgaactcctatctgttcggcggcaatgcttcg
tatgtagaagaactgtacgaagcctacctggacaatccggcatcggtgccggacaactgg
cgcgagtatttcgacgcgctgcagaatgtgccggcgacggacggttcgaatgcgaacgat
gttgcccacaatccgatcgtcgaatcgttcgcccagcgtgcgaaggccaacgccttcatt
ccgcgtgaaagcagcggcggcaatctcgccaccgcccgcaagcaggtccacgtccagtcc
ctgatcagcgcgtatcggttcctcggctcgcaatgggccaatctcgatcccctgaagcgc
cgcgaacgtcccgcgatccccgaactcgaacccgcgttctacgacttctccgaggccgac
ctcgaccagacgttcagcgcgagcaacctgtatttcggtttcgagcaggcttcgctgcgt
gacatcgtcaaatcgctgcgcgacacgtactgcggcacgatcggcgtcgagtacatgtac
atcggcgatccggagcagaagcgctggtggcaggagcgtctcgaatcgacgcgcgccacg
ccgaacttcagcgcggacaagaagaagcacgtgctgaaccgcctgacggccgccgaaggc
ctcgagcgctacctgcacaccaagtacgtcggccagaagcgcttctcgctcgaaggcggc
gagagcttcatcgcggcgatggacgaagtggtccagcactcgggctcgaagggcgtgcag
gagatcgtgatcggcatggcccaccgcggccgcctgaacgtgctcgtgaacacgctcggc
aagatgccggcggatctgttcgccgaattcgaaggcaagcacgtcgacgacctgccggcc
ggcgacgtcaagtatcacaagggtttctcgtcggacatcgcgaccgagggcggtccggtc
cacctgtcgctggcgttcaacccgtcgcacctggaaatcgtcaacccggtggtcgagggc
tcggcgaaggcgcgaatggaccgtcgcggcgacgcggacggcctgcaggtgctgccggtg
cagatccacggcgacgcggccttcgctggccagggcgtcgtgatggaaacgctgaacctc
gcgcagacgcgcggctacggcacgcacggcacgctgcacatcgtcatcaacaaccagatc
ggtttcacgacgtcggacccgcgcgatgcgcgctcgacgctgtactgcaccgacgtggtc
aagatgatcgaggcgccggtgctgcacgtgaacggcgacgatccggaagcggtggtcctc
gcggtgcagatcgcgatcgactatcgcatgcagttccacaaggatgtcgtgatcgacatc
gtctgcttccgcaagctcggccacaacgagcaggacacgccggccgtcacgcagccgttg
atgtacaagaagatcgcgcagcacccgggcacccgtgcgctgtacgccgagaagctggtg
cagcagggcgtgatcaccgccgagcagggcgacgagttcgtcaaggcctaccgcaaggcg
atggacgacggccaccacacggtcgatccggtgctctcgaactacaagagcaagtacgcg
gtcgactgggtgccgttcctgaaccgcaagtggaccgacgcggccgacacggccgtgccg
ctcgccgaactgaagcgcatcggcgaacgcatcacgacggtgccggagaacttcaaggtc
cacccgctcgtcgagcgcgtgatcaacgaccgccgcaagatggcgcagggcgaccagccg
ctggactggggcatgggcgagcacctcgcgttcgcctcgctggtctcgtccggctacgcc
gtgcgcctgaccggccaggattcgggccgcggcacgttcacgcaccgccacgcggtgctg
cacgaccagaaccgcgagcgctggaacgacggcacctacgtgccgctgcagaacgtctcg
gaaggccaggcgaacttcacggtgatcgactcggtgctgtcggaagaagcggtgctcggc
ttcgagtacggctactcgaccgcggaaccgaacacgctggtgctgtgggaagcgcagttc
ggcgacttcgtgaacggcgcgcaggtcgtgatcgaccagttcatctcgtcgggcgaagtg
aagtggggccgcgtctcgggcctgacgatgctgctgccgcacggctacgaaggccagggt
ccggagcactcgtcgacgcgtatcgagcgtttcctgcaactgtgcgcggatcacaacatg
caggtggtccagccgaccacgccggcgcagatcttccacctgctgcgccgccagatgatc
cgcctgttccgcaagccgctgatcgtggcgacgccgaagtcgctgctgcgtcacaaggaa
gccgtgtcggacctgtccgaactggcgaagggctcgttcctgccggtgatcggcgaggtc
gacgagacgatcgacgcgaagaaggtcaagcgcgtgatcgcctgctcggggcgcgtctat
tacgacatcgtcgcgcaccgccgcgaagccaaggcgcacgacgtcgcgatcgtccggatc
gagcagctctatccgttcgcgcacaagcagttcgaagcggaaatgaagaagtacgacaac
gcgaccgaagtggtctgggtgcaggatgagccgcagaatcagggtccgtggttctacatc
gaacaccacctgaaggaaggcatgaaggaagggcagaagctcgcgtacagcggccgcccg
gcttcggcttcgccggcggtcggttattacgcgaagcactacgagcagcagaaggccctg
atcgaaggggcattcggccgcctgaagagcgcgtcgatcgcaaaataa

DBGET integrated database retrieval system