KEGG   Burkholderia plantarii ATCC 43733: bpln_1g15890Help
Entry
bpln_1g15890      CDS       T04139                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bpla  Burkholderia plantarii ATCC 43733
Pathway
bpla00020  Citrate cycle (TCA cycle)
bpla00310  Lysine degradation
bpla00380  Tryptophan metabolism
bpla01100  Metabolic pathways
bpla01110  Biosynthesis of secondary metabolites
bpla01120  Microbial metabolism in diverse environments
bpla01130  Biosynthesis of antibiotics
bpla01200  Carbon metabolism
Module
bpla_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpla_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    bpln_1g15890
  09105 Amino acid metabolism
   00310 Lysine degradation
    bpln_1g15890
   00380 Tryptophan metabolism
    bpln_1g15890
Enzymes [BR:bpla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     bpln_1g15890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ALK30400
UniProt: A0A0B6RRW3
LinkDB All DBs
Position
1:1890547..1891824
Genome map
AA seq 425 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLSQV
LQNDGDTVVADQVIATIDTEAKAGAVAAAAGEAEVQPAPAPVAAAPAPAAQPAAAAGSSN
AASPAASKLLAEKGVDASQVAGTGRDGRITKGDALAANAAPAKAAAAPAAAAPKKAALPD
VKVPASASNWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRTKY
KDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLV
VPILRNADQLSLADIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINP
PQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPAR
LLLDL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgttgaagtcaaagtcccccagctttccgaatcggtgtcggaagcgaccatg
ctgcaatggaagaagaagcccggtgaagccgtcgcgcaggacgaaatcctgatcgaactc
gaaaccgacaaggtcgtgctcgaagtgccggcgccggccgccggcgtgctttcccaagtg
ctgcagaacgacggcgacaccgtcgtggccgatcaggtgatcgccaccatcgataccgaa
gcgaaggcaggtgccgtcgccgcggccgccggcgaagccgaagtgcaaccggctccggcg
cccgtcgccgcggcgccggcaccggccgcgcagccggctgccgcagcgggttcgagcaac
gccgcttcgccggccgcctcgaagctgctggccgagaagggcgtggacgcgagccaggtc
gccggcacgggccgcgacggccgcatcaccaagggtgacgcgctggccgcgaacgccgcg
ccggccaaggccgctgccgccccggccgccgccgcgccgaagaaggccgcgctgccggac
gtgaaggtgccggcctcggcctccaactggctgaacgaccgtccggagcagcgcgtgccg
atgtcgcgcctgcgcgcgcggatcgccgagcgtctgctcgaatcgcagcagaccaacgcg
atcctgacgacgttcaatgaagtgaacatgcagccggtcatggacctgcgcacgaagtac
aaggacaagttcgagaaggaacacggcgtgaagctcggcttcatgtcgttcttcgtcaag
gcggcggtccacgcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggcaacgac
atcgtctaccacggctacttcgacatcggtatcgcggtcggttcgccgcgcggcctggtg
gtgccgattctgcgcaacgccgaccagctgagcctggccgacatcgagaaaaagatcgcc
gagttcggtcagaaggccaaggacggcaagctgtcgatcgaggaaatgacgggcggtacg
ttctcgatctcgaacggcggcgtgttcggctcgatgctgtcgaccccgatcatcaacccg
ccgcagtcggcgatcctcggcgtccacgcgaccaaggagcgcccggtggtcgagaacggc
cagatcgtgatccgtccgatcaactacctcgcgctgtcgtatgaccaccggatcatcgac
ggccgcgaagcggtgctgtcgctggtcgcgatgaaggatgcgctggaagatccggcacgc
ctgctgctcgacctgtaa

DBGET integrated database retrieval system